Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   IXY25_RS00785 Genome accession   NZ_CP064846
Coordinates   136726..136899 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain BZR 86     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 131726..141899
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IXY25_RS00735 (IXY25_00725) comGD 131847..132284 (+) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  IXY25_RS00740 (IXY25_00730) comGE 132268..132582 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  IXY25_RS00745 (IXY25_00735) comGF 132491..132991 (+) 501 WP_226565836.1 competence type IV pilus minor pilin ComGF -
  IXY25_RS00750 (IXY25_00740) comGG 132992..133369 (+) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  IXY25_RS00755 (IXY25_00745) - 133426..133605 (+) 180 WP_003153093.1 YqzE family protein -
  IXY25_RS00760 (IXY25_00750) - 133645..133974 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  IXY25_RS00765 (IXY25_00755) tapA 134233..134904 (+) 672 WP_025852919.1 amyloid fiber anchoring/assembly protein TapA -
  IXY25_RS00770 (IXY25_00760) sipW 134876..135460 (+) 585 WP_025852917.1 signal peptidase I SipW -
  IXY25_RS00775 (IXY25_00765) tasA 135524..136309 (+) 786 WP_003153102.1 biofilm matrix protein TasA -
  IXY25_RS00780 (IXY25_00770) sinR 136357..136692 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  IXY25_RS00785 (IXY25_00775) sinI 136726..136899 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  IXY25_RS00790 (IXY25_00780) - 137076..137870 (-) 795 WP_014305407.1 YqhG family protein -
  IXY25_RS00795 (IXY25_00785) - 137888..139558 (-) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  IXY25_RS00800 (IXY25_00790) gcvT 139981..141081 (+) 1101 WP_003153108.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=505255 IXY25_RS00785 WP_003153105.1 136726..136899(-) (sinI) [Bacillus velezensis strain BZR 86]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=505255 IXY25_RS00785 WP_003153105.1 136726..136899(-) (sinI) [Bacillus velezensis strain BZR 86]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702