Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   IXY24_RS16705 Genome accession   NZ_CP064845
Coordinates   3348150..3348269 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain BZR 277     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 3343150..3353269
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IXY24_RS16680 (IXY24_16495) - 3343389..3344147 (-) 759 WP_003156330.1 ABC transporter ATP-binding protein -
  IXY24_RS16685 (IXY24_16500) - 3344141..3345088 (-) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  IXY24_RS16690 (IXY24_16505) ceuB 3345078..3346031 (-) 954 WP_003156332.1 ABC transporter permease Machinery gene
  IXY24_RS16695 (IXY24_16510) - 3346446..3347810 (+) 1365 WP_003156333.1 aspartate kinase -
  IXY24_RS16700 (IXY24_16515) - 3347890..3348000 (+) 111 WP_369719092.1 YjcZ family sporulation protein -
  IXY24_RS16705 (IXY24_16520) phrC 3348150..3348269 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  IXY24_RS16710 (IXY24_16525) rapC 3348253..3349401 (-) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  IXY24_RS16715 (IXY24_16530) - 3349554..3350987 (-) 1434 WP_162130794.1 HAMP domain-containing sensor histidine kinase -
  IXY24_RS16720 (IXY24_16535) - 3350974..3351657 (-) 684 WP_003156341.1 response regulator transcription factor -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=505230 IXY24_RS16705 WP_003156334.1 3348150..3348269(-) (phrC) [Bacillus velezensis strain BZR 277]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=505230 IXY24_RS16705 WP_003156334.1 3348150..3348269(-) (phrC) [Bacillus velezensis strain BZR 277]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718