Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   IXY24_RS06690 Genome accession   NZ_CP064845
Coordinates   1271033..1271347 (+) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain BZR 277     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1266033..1276347
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IXY24_RS06665 (IXY24_06590) - 1267073..1268023 (+) 951 WP_003153082.1 magnesium transporter CorA family protein -
  IXY24_RS06670 (IXY24_06595) comGA 1268215..1269285 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  IXY24_RS06675 (IXY24_06600) comGB 1269272..1270309 (+) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  IXY24_RS06680 (IXY24_06605) comGC 1270356..1270622 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  IXY24_RS06685 (IXY24_06610) comGD 1270612..1271049 (+) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  IXY24_RS06690 (IXY24_06615) comGE 1271033..1271347 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  IXY24_RS06695 (IXY24_06620) comGF 1271256..1271756 (+) 501 WP_226565836.1 competence type IV pilus minor pilin ComGF -
  IXY24_RS06700 (IXY24_06625) comGG 1271757..1272134 (+) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  IXY24_RS06705 (IXY24_06630) - 1272191..1272370 (+) 180 WP_003153093.1 YqzE family protein -
  IXY24_RS06710 (IXY24_06635) - 1272410..1272739 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  IXY24_RS06715 (IXY24_06640) tapA 1272998..1273669 (+) 672 WP_025852919.1 amyloid fiber anchoring/assembly protein TapA -
  IXY24_RS06720 (IXY24_06645) sipW 1273641..1274225 (+) 585 WP_025852917.1 signal peptidase I SipW -
  IXY24_RS06725 (IXY24_06650) tasA 1274289..1275074 (+) 786 WP_003153102.1 biofilm matrix protein TasA -
  IXY24_RS06730 (IXY24_06655) sinR 1275122..1275457 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  IXY24_RS06735 (IXY24_06660) sinI 1275491..1275664 (-) 174 WP_003153105.1 anti-repressor SinI Regulator

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=505197 IXY24_RS06690 WP_015388003.1 1271033..1271347(+) (comGE) [Bacillus velezensis strain BZR 277]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=505197 IXY24_RS06690 WP_015388003.1 1271033..1271347(+) (comGE) [Bacillus velezensis strain BZR 277]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGACGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGCGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481