Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ITP52_RS15450 Genome accession   NZ_CP064818
Coordinates   3093427..3093567 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SH1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3088427..3098567
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ITP52_RS15425 (ITP52_15425) yueI 3088720..3089118 (+) 399 WP_032726794.1 YueI family protein -
  ITP52_RS15430 (ITP52_15430) pncA 3089215..3089766 (+) 552 WP_043940186.1 isochorismatase family cysteine hydrolase -
  ITP52_RS15435 (ITP52_15435) pncB 3089782..3091254 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ITP52_RS15440 (ITP52_15440) pdeH 3091391..3092620 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ITP52_RS15445 (ITP52_15445) - 3092596..3092964 (-) 369 WP_041850584.1 hypothetical protein -
  ITP52_RS22270 - 3093143..3093205 (-) 63 Protein_3014 hypothetical protein -
  ITP52_RS15450 (ITP52_15450) degQ 3093427..3093567 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ITP52_RS15455 (ITP52_15455) - 3093751..3094611 (+) 861 WP_041850585.1 polyprenyl synthetase family protein -
  ITP52_RS15460 (ITP52_15460) comX 3094624..3094788 (+) 165 WP_015384519.1 competence pheromone ComX -
  ITP52_RS15465 (ITP52_15465) comP 3094800..3097100 (+) 2301 WP_088300729.1 histidine kinase Regulator
  ITP52_RS15470 (ITP52_15470) comA 3097181..3097825 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ITP52_RS15475 (ITP52_15475) yuxO 3097844..3098224 (+) 381 WP_003228810.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=504915 ITP52_RS15450 WP_003220708.1 3093427..3093567(+) (degQ) [Bacillus subtilis strain SH1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=504915 ITP52_RS15450 WP_003220708.1 3093427..3093567(+) (degQ) [Bacillus subtilis strain SH1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1