Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   KP952_RS12540 Genome accession   NZ_CP076731
Coordinates   2359879..2360253 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain Miz-8     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2354879..2365253
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KP952_RS12500 (KP952_12500) yqhG 2355211..2356005 (+) 795 WP_014480249.1 YqhG family protein -
  KP952_RS12505 (KP952_12505) sinI 2356188..2356361 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  KP952_RS12510 (KP952_12510) sinR 2356395..2356730 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KP952_RS12515 (KP952_12515) tasA 2356823..2357608 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  KP952_RS12520 (KP952_12520) sipW 2357672..2358244 (-) 573 WP_003230181.1 signal peptidase I SipW -
  KP952_RS12525 (KP952_12525) tapA 2358228..2358989 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  KP952_RS12530 (KP952_12530) yqzG 2359261..2359587 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KP952_RS12535 (KP952_12535) spoIITA 2359629..2359808 (-) 180 WP_014480252.1 YqzE family protein -
  KP952_RS12540 (KP952_12540) comGG 2359879..2360253 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  KP952_RS12545 (KP952_12545) comGF 2360254..2360637 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  KP952_RS12550 (KP952_12550) comGE 2360663..2361010 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  KP952_RS12555 (KP952_12555) comGD 2360994..2361425 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  KP952_RS12560 (KP952_12560) comGC 2361415..2361711 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  KP952_RS12565 (KP952_12565) comGB 2361725..2362762 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  KP952_RS12570 (KP952_12570) comGA 2362749..2363819 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  KP952_RS12575 (KP952_12575) - 2364031..2364228 (-) 198 WP_014480259.1 CBS domain-containing protein -
  KP952_RS12580 (KP952_12580) corA 2364230..2365183 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=504441 KP952_RS12540 WP_014480253.1 2359879..2360253(-) (comGG) [Bacillus subtilis subsp. subtilis strain Miz-8]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=504441 KP952_RS12540 WP_014480253.1 2359879..2360253(-) (comGG) [Bacillus subtilis subsp. subtilis strain Miz-8]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterProScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976