Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | IUJ46_RS04200 | Genome accession | NZ_CP064364 |
| Coordinates | 804987..805412 (-) | Length | 141 a.a. |
| NCBI ID | WP_011285575.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain PartK-Spyogenes-RM8376 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 769733..816998 | 804987..805412 | within | 0 |
Gene organization within MGE regions
Location: 769733..816998
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IUJ46_RS03970 (IUJ46_03955) | pfkA | 769733..770746 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| IUJ46_RS03975 (IUJ46_03960) | - | 770826..773936 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| IUJ46_RS03980 (IUJ46_03965) | - | 774121..774492 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| IUJ46_RS03985 (IUJ46_03970) | - | 774492..775190 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| IUJ46_RS03990 (IUJ46_03975) | - | 775200..775985 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| IUJ46_RS03995 (IUJ46_03980) | - | 776112..776726 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| IUJ46_RS04005 (IUJ46_03990) | prx | 777317..777505 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| IUJ46_RS04010 (IUJ46_03995) | speA | 777726..778481 (+) | 756 | WP_009880239.1 | streptococcal pyrogenic exotoxin SpeA | - |
| IUJ46_RS04015 (IUJ46_04000) | - | 778603..779262 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| IUJ46_RS04020 (IUJ46_04005) | - | 779262..779483 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| IUJ46_RS04025 (IUJ46_04010) | - | 779493..780266 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| IUJ46_RS04030 (IUJ46_04015) | - | 780277..780879 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| IUJ46_RS04035 (IUJ46_04020) | - | 780891..781655 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| IUJ46_RS04040 (IUJ46_04025) | - | 781657..781989 (-) | 333 | WP_011285562.1 | phage holin | - |
| IUJ46_RS04045 (IUJ46_04030) | - | 781989..782312 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| IUJ46_RS09825 | - | 782326..782448 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| IUJ46_RS04050 (IUJ46_04035) | - | 782462..782809 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| IUJ46_RS04055 (IUJ46_04040) | - | 782820..784682 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| IUJ46_RS04060 (IUJ46_04045) | - | 784687..788127 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| IUJ46_RS04065 (IUJ46_04050) | - | 788128..789612 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| IUJ46_RS04070 (IUJ46_04055) | - | 789613..791418 (-) | 1806 | WP_011054802.1 | tail protein | - |
| IUJ46_RS04075 (IUJ46_04060) | - | 791411..791869 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| IUJ46_RS04080 (IUJ46_04065) | - | 791842..792159 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| IUJ46_RS04085 (IUJ46_04070) | - | 792172..792678 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| IUJ46_RS04090 (IUJ46_04075) | - | 792690..793100 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| IUJ46_RS04095 (IUJ46_04080) | - | 793102..793497 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| IUJ46_RS04100 (IUJ46_04085) | - | 793494..793805 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| IUJ46_RS04105 (IUJ46_04090) | - | 793802..794140 (-) | 339 | WP_029714010.1 | hypothetical protein | - |
| IUJ46_RS04110 (IUJ46_04095) | - | 794154..794447 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| IUJ46_RS04115 (IUJ46_04100) | - | 794460..795350 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| IUJ46_RS04120 (IUJ46_04105) | - | 795369..795938 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| IUJ46_RS09830 | - | 796047..796181 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| IUJ46_RS04125 (IUJ46_04110) | - | 796183..796452 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| IUJ46_RS04130 (IUJ46_04115) | - | 796459..797367 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| IUJ46_RS04135 (IUJ46_04120) | - | 797336..798661 (-) | 1326 | WP_029714009.1 | phage portal protein | - |
| IUJ46_RS04140 (IUJ46_04125) | - | 798661..799935 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| IUJ46_RS04145 (IUJ46_04130) | - | 799925..800305 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| IUJ46_RS04150 (IUJ46_04135) | - | 800915..801349 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| IUJ46_RS04155 (IUJ46_04140) | - | 801635..801901 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| IUJ46_RS04160 (IUJ46_04145) | - | 801898..802422 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| IUJ46_RS04165 (IUJ46_04150) | - | 802425..803057 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| IUJ46_RS04170 (IUJ46_04155) | - | 803059..803343 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| IUJ46_RS04175 (IUJ46_04160) | - | 803340..803510 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| IUJ46_RS04180 (IUJ46_04165) | - | 803507..803743 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| IUJ46_RS09865 | - | 803743..803988 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| IUJ46_RS04185 (IUJ46_04170) | - | 803985..804341 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| IUJ46_RS04190 (IUJ46_04175) | - | 804338..804778 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| IUJ46_RS04195 (IUJ46_04180) | - | 804778..804981 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| IUJ46_RS04200 (IUJ46_04185) | ssb | 804987..805412 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| IUJ46_RS04205 (IUJ46_04190) | - | 805405..806079 (-) | 675 | WP_046735269.1 | ERF family protein | - |
| IUJ46_RS04210 (IUJ46_04195) | - | 806080..806562 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| IUJ46_RS04215 (IUJ46_04200) | - | 806584..806838 (-) | 255 | WP_011018143.1 | hypothetical protein | - |
| IUJ46_RS04220 (IUJ46_04205) | - | 806819..807172 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| IUJ46_RS04225 (IUJ46_04210) | - | 807313..808095 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| IUJ46_RS04230 (IUJ46_04215) | - | 808082..808912 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| IUJ46_RS04235 (IUJ46_04220) | - | 808926..809240 (-) | 315 | WP_023610888.1 | helix-turn-helix transcriptional regulator | - |
| IUJ46_RS09835 | - | 809256..809390 (-) | 135 | WP_002995985.1 | hypothetical protein | - |
| IUJ46_RS04240 (IUJ46_04225) | - | 809387..809683 (-) | 297 | WP_011054584.1 | MerR family transcriptional regulator | - |
| IUJ46_RS04245 (IUJ46_04230) | - | 809720..809983 (-) | 264 | WP_029714276.1 | hypothetical protein | - |
| IUJ46_RS04250 (IUJ46_04235) | - | 810038..810547 (+) | 510 | WP_011017884.1 | hypothetical protein | - |
| IUJ46_RS04255 (IUJ46_04240) | - | 810678..810887 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| IUJ46_RS04260 (IUJ46_04245) | - | 810997..811197 (-) | 201 | WP_002992770.1 | helix-turn-helix transcriptional regulator | - |
| IUJ46_RS04265 (IUJ46_04250) | - | 811271..811657 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| IUJ46_RS04270 (IUJ46_04255) | - | 811646..811855 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| IUJ46_RS04275 (IUJ46_04260) | - | 811909..812508 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| IUJ46_RS04280 (IUJ46_04265) | - | 812538..812696 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| IUJ46_RS04285 (IUJ46_04270) | - | 813053..813877 (+) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| IUJ46_RS04290 (IUJ46_04275) | - | 813913..814806 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| IUJ46_RS04295 (IUJ46_04280) | - | 814927..816015 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| IUJ46_RS04300 (IUJ46_04285) | - | 816378..816998 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15995.63 Da Isoelectric Point: 4.5748
>NTDB_id=501068 IUJ46_RS04200 WP_011285575.1 804987..805412(-) (ssb) [Streptococcus pyogenes strain PartK-Spyogenes-RM8376]
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=501068 IUJ46_RS04200 WP_011285575.1 804987..805412(-) (ssb) [Streptococcus pyogenes strain PartK-Spyogenes-RM8376]
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.66 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.262 |
100 |
0.433 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.262 |
100 |
0.433 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.786 |
79.433 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
40.426 |
100 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
29.379 |
100 |
0.369 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
49.524 |
74.468 |
0.369 |