Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | IRJ27_RS18140 | Genome accession | NZ_CP064095 |
| Coordinates | 3522175..3522585 (+) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis strain N1303-2Ay | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3475729..3537429 | 3522175..3522585 | within | 0 |
Gene organization within MGE regions
Location: 3475729..3537429
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IRJ27_RS17810 | sknR | 3475729..3476079 (-) | 351 | WP_004398704.1 | transcriptional regulator SknR | - |
| IRJ27_RS17815 | yqaF | 3476256..3476486 (+) | 231 | WP_004398958.1 | helix-turn-helix transcriptional regulator | - |
| IRJ27_RS17820 | - | 3476516..3476656 (+) | 141 | WP_003229902.1 | hypothetical protein | - |
| IRJ27_RS17825 | yqaG | 3476730..3477299 (+) | 570 | WP_004398626.1 | helix-turn-helix transcriptional regulator | - |
| IRJ27_RS17830 | sknH | 3477296..3477553 (+) | 258 | WP_003245994.1 | YqaH family protein | - |
| IRJ27_RS17835 | - | 3477550..3477723 (+) | 174 | WP_119123069.1 | hypothetical protein | - |
| IRJ27_RS17840 | - | 3477683..3477877 (+) | 195 | WP_003229905.1 | hypothetical protein | - |
| IRJ27_RS17845 | yqaJ | 3477983..3478942 (+) | 960 | WP_004398673.1 | YqaJ viral recombinase family protein | - |
| IRJ27_RS17850 | yqaK | 3478945..3479799 (+) | 855 | WP_003229907.1 | recombinase RecT | - |
| IRJ27_RS17855 | yqaL | 3479875..3480552 (+) | 678 | WP_010886575.1 | DnaD domain protein | - |
| IRJ27_RS17860 | sknM | 3480434..3481375 (+) | 942 | WP_075058863.1 | ATP-binding protein | - |
| IRJ27_RS17865 | - | 3481366..3481515 (+) | 150 | WP_003229910.1 | hypothetical protein | - |
| IRJ27_RS17870 | yqaN | 3481611..3482039 (+) | 429 | WP_009967809.1 | RusA family crossover junction endodeoxyribonuclease | - |
| IRJ27_RS17875 | yqaO | 3482121..3482327 (+) | 207 | WP_003229912.1 | XtrA/YqaO family protein | - |
| IRJ27_RS17880 | - | 3482401..3483330 (-) | 930 | WP_003229913.1 | hypothetical protein | - |
| IRJ27_RS17885 | yqaQ | 3483528..3483983 (+) | 456 | WP_004398775.1 | hypothetical protein | - |
| IRJ27_RS17890 | - | 3484127..3484591 (+) | 465 | WP_004398685.1 | hypothetical protein | - |
| IRJ27_RS17895 | terS | 3484659..3485378 (+) | 720 | WP_003229916.1 | phage terminase small subunit | - |
| IRJ27_RS17900 | yqaT | 3485371..3486666 (+) | 1296 | WP_003229917.1 | PBSX family phage terminase large subunit | - |
| IRJ27_RS17905 | yqbA | 3486670..3488202 (+) | 1533 | WP_004398894.1 | phage portal protein | - |
| IRJ27_RS17910 | yqbB | 3488199..3489116 (+) | 918 | WP_004398748.1 | phage head morphogenesis protein | - |
| IRJ27_RS17915 | - | 3489157..3489810 (+) | 654 | WP_003229920.1 | hypothetical protein | - |
| IRJ27_RS17920 | yqbD | 3489843..3490811 (+) | 969 | WP_003229921.1 | XkdF-like putative serine protease domain-containing protein | - |
| IRJ27_RS17925 | yqbE | 3490830..3491765 (+) | 936 | WP_003229922.1 | phage major capsid protein | - |
| IRJ27_RS17930 | yqbF | 3491776..3492087 (+) | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
| IRJ27_RS17935 | yqbG | 3492091..3492486 (+) | 396 | WP_004398566.1 | DUF3199 family protein | - |
| IRJ27_RS17940 | yqbH | 3492483..3492845 (+) | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
| IRJ27_RS17945 | yqbI | 3492842..3493345 (+) | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
| IRJ27_RS17950 | yqbJ | 3493358..3493795 (+) | 438 | WP_003229927.1 | DUF6838 family protein | - |
| IRJ27_RS17955 | - | 3493792..3493983 (+) | 192 | WP_010886574.1 | hypothetical protein | - |
| IRJ27_RS17960 | yqbK | 3493984..3495384 (+) | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
| IRJ27_RS17965 | yqbM | 3495387..3495830 (+) | 444 | WP_003229930.1 | phage tail tube protein | - |
| IRJ27_RS17970 | bsrH | 3496084..3496173 (-) | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
| IRJ27_RS17975 | txpA | 3496553..3496732 (-) | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | - |
| IRJ27_RS17980 | - | 3496878..3497327 (+) | 450 | WP_003229933.1 | phage portal protein | - |
| IRJ27_RS17985 | - | 3497369..3497506 (+) | 138 | WP_003229934.1 | hypothetical protein | - |
| IRJ27_RS17990 | yqbO | 3497509..3502266 (+) | 4758 | WP_003246092.1 | phage tail tape measure protein | - |
| IRJ27_RS17995 | yqbP | 3502259..3502918 (+) | 660 | WP_242743359.1 | LysM peptidoglycan-binding domain-containing protein | - |
| IRJ27_RS18000 | yqbQ | 3502931..3503911 (+) | 981 | WP_004398524.1 | hypothetical protein | - |
| IRJ27_RS18005 | yqbR | 3503908..3504171 (+) | 264 | WP_003229938.1 | DUF2577 family protein | - |
| IRJ27_RS18010 | yqbS | 3504184..3504609 (+) | 426 | WP_004398572.1 | DUF2634 domain-containing protein | - |
| IRJ27_RS18015 | yqbT | 3504602..3505648 (+) | 1047 | WP_003229940.1 | baseplate J/gp47 family protein | - |
| IRJ27_RS18020 | yqcA | 3505632..3506210 (+) | 579 | WP_003229941.1 | YmfQ family protein | - |
| IRJ27_RS18025 | - | 3506207..3506479 (+) | 273 | WP_003229942.1 | hypothetical protein | - |
| IRJ27_RS18030 | yqcC | 3506482..3507582 (+) | 1101 | WP_003229943.1 | pyocin knob domain-containing protein | - |
| IRJ27_RS18035 | yqcD | 3507592..3507927 (+) | 336 | WP_009967793.1 | XkdW family protein | - |
| IRJ27_RS18040 | yqcE | 3507924..3508088 (+) | 165 | WP_003229944.1 | XkdX family protein | - |
| IRJ27_RS18045 | yqxG | 3508176..3509069 (+) | 894 | WP_003246010.1 | hypothetical protein | - |
| IRJ27_RS18050 | yqxH | 3509114..3509536 (+) | 423 | WP_003246208.1 | holin family protein | - |
| IRJ27_RS18055 | cwlA | 3509581..3510399 (+) | 819 | WP_003229946.1 | N-acetylmuramoyl-L-alanine amidase CwlA | - |
| IRJ27_RS18060 | - | 3510564..3511043 (+) | 480 | WP_004399085.1 | hypothetical protein | - |
| IRJ27_RS18065 | - | 3511059..3511421 (+) | 363 | WP_003229947.1 | hypothetical protein | - |
| IRJ27_RS18070 | - | 3511418..3511564 (-) | 147 | WP_009967791.1 | hypothetical protein | - |
| IRJ27_RS18075 | yqcF | 3511682..3512260 (-) | 579 | WP_009967790.1 | type VII secretion system immunity protein YqcF | - |
| IRJ27_RS18080 | yqcG | 3512275..3513870 (-) | 1596 | WP_004399034.1 | LXG family T7SS effector endonuclease toxin YqcG | - |
| IRJ27_RS18085 | - | 3514240..3514398 (-) | 159 | WP_003245945.1 | hypothetical protein | - |
| IRJ27_RS18090 | phrE | 3514508..3514642 (-) | 135 | WP_004398770.1 | phosphatase RapE inhibitor PhrE | - |
| IRJ27_RS18095 | rapE | 3514632..3515759 (-) | 1128 | WP_004398842.1 | response regulator aspartate phosphatase RapE | - |
| IRJ27_RS18100 | yqcI | 3516202..3516966 (+) | 765 | WP_004398670.1 | YqcI/YcgG family protein | - |
| IRJ27_RS18105 | arsR | 3517338..3517655 (+) | 318 | WP_004399122.1 | arsenical resistance operon transcriptional regulator ArsR | - |
| IRJ27_RS18110 | yqcK | 3517716..3518156 (+) | 441 | WP_003229954.1 | ArsI/CadI family heavy metal resistance metalloenzyme | - |
| IRJ27_RS18115 | acr3 | 3518179..3519219 (+) | 1041 | WP_004398718.1 | arsenite efflux transporter Acr3 | - |
| IRJ27_RS18120 | arsC | 3519231..3519650 (+) | 420 | WP_004398596.1 | thioredoxin-dependent arsenate reductase | - |
| IRJ27_RS18125 | - | 3520005..3520183 (+) | 179 | Protein_3512 | hypothetical protein | - |
| IRJ27_RS18130 | spoIVCA | 3520141..3521601 (+) | 1461 | WP_223257626.1 | site-specific DNA recombinase SpoIVCA | - |
| IRJ27_RS18135 | - | 3521632..3521979 (-) | 348 | Protein_3514 | sigma-70 family RNA polymerase sigma factor | - |
| IRJ27_RS18140 | nucA/comI | 3522175..3522585 (+) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| IRJ27_RS18145 | yqeB | 3522618..3523340 (-) | 723 | WP_010886572.1 | hypothetical protein | - |
| IRJ27_RS18150 | gnd | 3523592..3524485 (+) | 894 | WP_003229961.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| IRJ27_RS18155 | yqeD | 3524504..3525130 (-) | 627 | WP_003229962.1 | TVP38/TMEM64 family protein | - |
| IRJ27_RS18160 | cwlH | 3525317..3526069 (+) | 753 | WP_003229963.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| IRJ27_RS18165 | yqeF | 3526321..3527052 (+) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
| IRJ27_RS18170 | - | 3527358..3527498 (-) | 141 | WP_003226124.1 | sporulation histidine kinase inhibitor Sda | - |
| IRJ27_RS18175 | yqeG | 3527860..3528378 (+) | 519 | WP_003226126.1 | YqeG family HAD IIIA-type phosphatase | - |
| IRJ27_RS18180 | yqeH | 3528382..3529482 (+) | 1101 | WP_003229966.1 | ribosome biogenesis GTPase YqeH | - |
| IRJ27_RS18185 | aroE | 3529500..3530342 (+) | 843 | WP_003229967.1 | shikimate dehydrogenase | - |
| IRJ27_RS18190 | yhbY | 3530336..3530626 (+) | 291 | WP_003226133.1 | ribosome assembly RNA-binding protein YhbY | - |
| IRJ27_RS18195 | nadD | 3530638..3531207 (+) | 570 | WP_004398676.1 | nicotinate-nucleotide adenylyltransferase | - |
| IRJ27_RS18200 | yqeK | 3531197..3531757 (+) | 561 | WP_004399059.1 | bis(5'-nucleosyl)-tetraphosphatase (symmetrical) YqeK | - |
| IRJ27_RS18205 | rsfS | 3531775..3532131 (+) | 357 | WP_003229971.1 | ribosome silencing factor | - |
| IRJ27_RS18210 | yqeM | 3532128..3532871 (+) | 744 | WP_003229973.1 | class I SAM-dependent methyltransferase | - |
| IRJ27_RS18215 | comER | 3532937..3533758 (-) | 822 | WP_004398597.1 | late competence protein ComER | - |
| IRJ27_RS18220 | comEA | 3533842..3534459 (+) | 618 | WP_004398514.1 | competence protein ComEA | Machinery gene |
| IRJ27_RS18225 | comEB | 3534526..3535095 (+) | 570 | WP_003229978.1 | ComE operon protein 2 | - |
| IRJ27_RS18230 | comEC | 3535099..3537429 (+) | 2331 | WP_009967776.1 | DNA internalization-related competence protein ComEC/Rec2 | Machinery gene |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=499421 IRJ27_RS18140 WP_009967785.1 3522175..3522585(+) (nucA/comI) [Bacillus subtilis strain N1303-2Ay]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=499421 IRJ27_RS18140 WP_009967785.1 3522175..3522585(+) (nucA/comI) [Bacillus subtilis strain N1303-2Ay]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |