Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | IRJ26_RS15950 | Genome accession | NZ_CP064094 |
| Coordinates | 3033314..3033724 (+) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis strain N1108-5at | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2983007..3038358 | 3033314..3033724 | within | 0 |
Gene organization within MGE regions
Location: 2983007..3038358
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IRJ26_RS15580 | psiE | 2983007..2983423 (+) | 417 | WP_003246154.1 | phosphate-starvation-inducible protein PsiE | - |
| IRJ26_RS15585 | - | 2983968..2984132 (+) | 165 | WP_010886576.1 | hypothetical protein | - |
| IRJ26_RS15590 | - | 2984075..2984275 (+) | 201 | Protein_3002 | recombinase family protein | - |
| IRJ26_RS15595 | - | 2984241..2984357 (-) | 117 | WP_003229898.1 | hypothetical protein | - |
| IRJ26_RS15600 | - | 2984357..2984749 (-) | 393 | Protein_3004 | sigma-70 family RNA polymerase sigma factor | - |
| IRJ26_RS15605 | yqaB | 2984755..2985273 (-) | 519 | WP_004399097.1 | ImmA/IrrE family metallo-endopeptidase | - |
| IRJ26_RS15610 | yqaC | 2985542..2986078 (+) | 537 | WP_004399117.1 | AAA family ATPase | - |
| IRJ26_RS15615 | - | 2986434..2986601 (+) | 168 | WP_003229900.1 | hypothetical protein | - |
| IRJ26_RS15620 | sknR | 2986868..2987218 (-) | 351 | WP_004398704.1 | transcriptional regulator SknR | - |
| IRJ26_RS15625 | yqaF | 2987395..2987625 (+) | 231 | WP_004398958.1 | helix-turn-helix transcriptional regulator | - |
| IRJ26_RS15630 | - | 2987655..2987795 (+) | 141 | WP_003229902.1 | hypothetical protein | - |
| IRJ26_RS15635 | yqaG | 2987869..2988438 (+) | 570 | WP_004398626.1 | helix-turn-helix transcriptional regulator | - |
| IRJ26_RS15640 | sknH | 2988435..2988692 (+) | 258 | WP_003245994.1 | YqaH family protein | - |
| IRJ26_RS15645 | - | 2988689..2988862 (+) | 174 | WP_119123069.1 | hypothetical protein | - |
| IRJ26_RS15650 | - | 2988822..2989016 (+) | 195 | WP_003229905.1 | hypothetical protein | - |
| IRJ26_RS15655 | yqaJ | 2989122..2990081 (+) | 960 | WP_004398673.1 | YqaJ viral recombinase family protein | - |
| IRJ26_RS15660 | yqaK | 2990084..2990938 (+) | 855 | WP_003229907.1 | recombinase RecT | - |
| IRJ26_RS15665 | yqaL | 2991014..2991691 (+) | 678 | WP_010886575.1 | DnaD domain protein | - |
| IRJ26_RS15670 | sknM | 2991573..2992514 (+) | 942 | WP_075058863.1 | ATP-binding protein | - |
| IRJ26_RS15675 | - | 2992505..2992654 (+) | 150 | WP_003229910.1 | hypothetical protein | - |
| IRJ26_RS15680 | yqaN | 2992750..2993178 (+) | 429 | WP_009967809.1 | RusA family crossover junction endodeoxyribonuclease | - |
| IRJ26_RS15685 | yqaO | 2993260..2993466 (+) | 207 | WP_003229912.1 | XtrA/YqaO family protein | - |
| IRJ26_RS15690 | - | 2993540..2994469 (-) | 930 | WP_003229913.1 | hypothetical protein | - |
| IRJ26_RS15695 | yqaQ | 2994667..2995122 (+) | 456 | WP_004398775.1 | hypothetical protein | - |
| IRJ26_RS15700 | - | 2995266..2995730 (+) | 465 | WP_004398685.1 | hypothetical protein | - |
| IRJ26_RS15705 | terS | 2995798..2996517 (+) | 720 | WP_003229916.1 | phage terminase small subunit | - |
| IRJ26_RS15710 | yqaT | 2996510..2997805 (+) | 1296 | WP_003229917.1 | PBSX family phage terminase large subunit | - |
| IRJ26_RS15715 | yqbA | 2997809..2999341 (+) | 1533 | WP_004398894.1 | phage portal protein | - |
| IRJ26_RS15720 | yqbB | 2999338..3000255 (+) | 918 | WP_004398748.1 | phage head morphogenesis protein | - |
| IRJ26_RS15725 | - | 3000296..3000949 (+) | 654 | WP_003229920.1 | hypothetical protein | - |
| IRJ26_RS15730 | yqbD | 3000982..3001950 (+) | 969 | WP_003229921.1 | XkdF-like putative serine protease domain-containing protein | - |
| IRJ26_RS15735 | yqbE | 3001969..3002904 (+) | 936 | WP_003229922.1 | phage major capsid protein | - |
| IRJ26_RS15740 | yqbF | 3002915..3003226 (+) | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
| IRJ26_RS15745 | yqbG | 3003230..3003625 (+) | 396 | WP_004398566.1 | DUF3199 family protein | - |
| IRJ26_RS15750 | yqbH | 3003622..3003984 (+) | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
| IRJ26_RS15755 | yqbI | 3003981..3004484 (+) | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
| IRJ26_RS15760 | yqbJ | 3004497..3004934 (+) | 438 | WP_003229927.1 | DUF6838 family protein | - |
| IRJ26_RS15765 | - | 3004931..3005122 (+) | 192 | WP_010886574.1 | hypothetical protein | - |
| IRJ26_RS15770 | yqbK | 3005123..3006523 (+) | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
| IRJ26_RS15775 | yqbM | 3006526..3006969 (+) | 444 | WP_003229930.1 | phage tail tube protein | - |
| IRJ26_RS15780 | bsrH | 3007223..3007312 (-) | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
| IRJ26_RS15785 | txpA | 3007692..3007871 (-) | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | - |
| IRJ26_RS15790 | - | 3008017..3008466 (+) | 450 | WP_003229933.1 | phage portal protein | - |
| IRJ26_RS15795 | - | 3008508..3008645 (+) | 138 | WP_003229934.1 | hypothetical protein | - |
| IRJ26_RS15800 | yqbO | 3008648..3013405 (+) | 4758 | WP_003246092.1 | phage tail tape measure protein | - |
| IRJ26_RS15805 | yqbP | 3013398..3014057 (+) | 660 | WP_004398548.1 | LysM peptidoglycan-binding domain-containing protein | - |
| IRJ26_RS15810 | yqbQ | 3014070..3015050 (+) | 981 | WP_004398524.1 | hypothetical protein | - |
| IRJ26_RS15815 | yqbR | 3015047..3015310 (+) | 264 | WP_003229938.1 | DUF2577 family protein | - |
| IRJ26_RS15820 | yqbS | 3015323..3015748 (+) | 426 | WP_004398572.1 | DUF2634 domain-containing protein | - |
| IRJ26_RS15825 | yqbT | 3015741..3016787 (+) | 1047 | WP_003229940.1 | baseplate J/gp47 family protein | - |
| IRJ26_RS15830 | yqcA | 3016771..3017349 (+) | 579 | WP_003229941.1 | YmfQ family protein | - |
| IRJ26_RS15835 | - | 3017346..3017618 (+) | 273 | WP_003229942.1 | hypothetical protein | - |
| IRJ26_RS15840 | yqcC | 3017621..3018721 (+) | 1101 | WP_003229943.1 | pyocin knob domain-containing protein | - |
| IRJ26_RS15845 | yqcD | 3018731..3019066 (+) | 336 | WP_009967793.1 | XkdW family protein | - |
| IRJ26_RS15850 | yqcE | 3019063..3019227 (+) | 165 | WP_003229944.1 | XkdX family protein | - |
| IRJ26_RS15855 | yqxG | 3019315..3020208 (+) | 894 | WP_003246010.1 | hypothetical protein | - |
| IRJ26_RS15860 | yqxH | 3020253..3020675 (+) | 423 | WP_003246208.1 | holin family protein | - |
| IRJ26_RS15865 | cwlA | 3020720..3021538 (+) | 819 | WP_003229946.1 | N-acetylmuramoyl-L-alanine amidase CwlA | - |
| IRJ26_RS15870 | - | 3021703..3022182 (+) | 480 | WP_004399085.1 | hypothetical protein | - |
| IRJ26_RS15875 | - | 3022198..3022560 (+) | 363 | WP_003229947.1 | hypothetical protein | - |
| IRJ26_RS15880 | - | 3022557..3022703 (-) | 147 | WP_009967791.1 | hypothetical protein | - |
| IRJ26_RS15885 | yqcF | 3022821..3023399 (-) | 579 | WP_009967790.1 | type VII secretion system immunity protein YqcF | - |
| IRJ26_RS15890 | yqcG | 3023414..3025009 (-) | 1596 | WP_004399034.1 | LXG family T7SS effector endonuclease toxin YqcG | - |
| IRJ26_RS15895 | - | 3025379..3025537 (-) | 159 | WP_003245945.1 | hypothetical protein | - |
| IRJ26_RS15900 | phrE | 3025647..3025781 (-) | 135 | WP_004398770.1 | phosphatase RapE inhibitor PhrE | - |
| IRJ26_RS15905 | rapE | 3025771..3026898 (-) | 1128 | WP_004398842.1 | response regulator aspartate phosphatase RapE | - |
| IRJ26_RS15910 | yqcI | 3027341..3028105 (+) | 765 | WP_004398670.1 | YqcI/YcgG family protein | - |
| IRJ26_RS15915 | arsR | 3028477..3028794 (+) | 318 | WP_004399122.1 | arsenical resistance operon transcriptional regulator ArsR | - |
| IRJ26_RS15920 | yqcK | 3028855..3029295 (+) | 441 | WP_003229954.1 | ArsI/CadI family heavy metal resistance metalloenzyme | - |
| IRJ26_RS15925 | acr3 | 3029318..3030358 (+) | 1041 | WP_004398718.1 | arsenite efflux transporter Acr3 | - |
| IRJ26_RS15930 | arsC | 3030370..3030789 (+) | 420 | WP_004398596.1 | thioredoxin-dependent arsenate reductase | - |
| IRJ26_RS15935 | - | 3031144..3031322 (+) | 179 | Protein_3071 | hypothetical protein | - |
| IRJ26_RS15940 | spoIVCA | 3031280..3032740 (+) | 1461 | WP_223257626.1 | site-specific DNA recombinase SpoIVCA | - |
| IRJ26_RS15945 | - | 3032771..3033118 (-) | 348 | Protein_3073 | sigma-70 family RNA polymerase sigma factor | - |
| IRJ26_RS15950 | nucA/comI | 3033314..3033724 (+) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| IRJ26_RS15955 | yqeB | 3033757..3034479 (-) | 723 | WP_010886572.1 | hypothetical protein | - |
| IRJ26_RS15960 | gnd | 3034731..3035624 (+) | 894 | WP_003229961.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| IRJ26_RS15965 | yqeD | 3035643..3036269 (-) | 627 | WP_003229962.1 | TVP38/TMEM64 family protein | - |
| IRJ26_RS15970 | cwlH | 3036456..3037208 (+) | 753 | WP_003229963.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| IRJ26_RS15975 | yqeF | 3037460..3038191 (+) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=499329 IRJ26_RS15950 WP_009967785.1 3033314..3033724(+) (nucA/comI) [Bacillus subtilis strain N1108-5at]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=499329 IRJ26_RS15950 WP_009967785.1 3033314..3033724(+) (nucA/comI) [Bacillus subtilis strain N1108-5at]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |