Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   IRJ24_RS14245 Genome accession   NZ_CP064093
Coordinates   2717225..2717398 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain N1282-4at     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2712225..2722398
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IRJ24_RS14200 comGE 2712576..2712923 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  IRJ24_RS14205 comGF 2712949..2713332 (+) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  IRJ24_RS14210 comGG 2713333..2713707 (+) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  IRJ24_RS14215 spoIIT 2713778..2713957 (+) 180 WP_003230176.1 YqzE family protein -
  IRJ24_RS14220 yqzG 2713999..2714325 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  IRJ24_RS14225 tapA 2714597..2715358 (+) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  IRJ24_RS14230 sipW 2715342..2715914 (+) 573 WP_003246088.1 signal peptidase I -
  IRJ24_RS14235 tasA 2715978..2716763 (+) 786 WP_004398632.1 biofilm matrix protein TasA -
  IRJ24_RS14240 sinR 2716856..2717191 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  IRJ24_RS14245 sinI 2717225..2717398 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  IRJ24_RS14250 yqhG 2717581..2718375 (-) 795 WP_003230200.1 YqhG family protein -
  IRJ24_RS14255 yqhH 2718396..2720069 (-) 1674 WP_004398544.1 SNF2-related protein -
  IRJ24_RS14260 gcvT 2720511..2721599 (+) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=499242 IRJ24_RS14245 WP_003230187.1 2717225..2717398(-) (sinI) [Bacillus subtilis strain N1282-4at]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=499242 IRJ24_RS14245 WP_003230187.1 2717225..2717398(-) (sinI) [Bacillus subtilis strain N1282-4at]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1