Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   IRJ24_RS10385 Genome accession   NZ_CP064093
Coordinates   2013824..2013991 (+) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain N1282-4at     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 2008824..2018991
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IRJ24_RS10355 pncB 2008969..2010441 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  IRJ24_RS10360 pdeH 2010578..2011807 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  IRJ24_RS10365 - 2011783..2012151 (-) 369 WP_003243784.1 hypothetical protein -
  IRJ24_RS10370 - 2012265..2012390 (-) 126 WP_003228793.1 hypothetical protein -
  IRJ24_RS10375 degQ 2012612..2012752 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  IRJ24_RS10380 comQ 2012937..2013836 (+) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  IRJ24_RS10385 comX 2013824..2013991 (+) 168 WP_003242801.1 competence pheromone ComX Regulator
  IRJ24_RS10390 comP 2014006..2016314 (+) 2309 Protein_1989 two-component system sensor histidine kinase ComP -
  IRJ24_RS10395 comA 2016395..2017039 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  IRJ24_RS10400 yuxO 2017058..2017438 (+) 381 WP_003228810.1 hotdog fold thioesterase -
  IRJ24_RS10405 mnhG 2017477..2017851 (-) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  IRJ24_RS10410 mrpF 2017835..2018119 (-) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  IRJ24_RS10415 mrpE 2018119..2018595 (-) 477 WP_003244015.1 Na+/H+ antiporter subunit E -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=499219 IRJ24_RS10385 WP_003242801.1 2013824..2013991(+) (comX) [Bacillus subtilis strain N1282-4at]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=499219 IRJ24_RS10385 WP_003242801.1 2013824..2013991(+) (comX) [Bacillus subtilis strain N1282-4at]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1