Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   BACVE_RS16750 Genome accession   NZ_CP063687
Coordinates   3273677..3273850 (-) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain NST6     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3268677..3278850
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BACVE_RS16700 (BACVE_003367) comGD 3268796..3269233 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  BACVE_RS16705 (BACVE_003368) comGE 3269217..3269531 (+) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  BACVE_RS16710 (BACVE_003369) comGF 3269545..3269940 (+) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  BACVE_RS16715 (BACVE_003370) comGG 3269941..3270318 (+) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  BACVE_RS16720 (BACVE_003371) - 3270375..3270554 (+) 180 WP_003153093.1 YqzE family protein -
  BACVE_RS16725 (BACVE_003372) - 3270595..3270924 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BACVE_RS16730 (BACVE_003373) tapA 3271183..3271854 (+) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  BACVE_RS16735 (BACVE_003374) - 3271826..3272410 (+) 585 WP_014418370.1 signal peptidase I -
  BACVE_RS16740 (BACVE_003375) - 3272475..3273260 (+) 786 WP_017418136.1 TasA family protein -
  BACVE_RS16745 (BACVE_003376) sinR 3273308..3273643 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BACVE_RS16750 (BACVE_003377) sinI 3273677..3273850 (-) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  BACVE_RS16755 (BACVE_003378) - 3274027..3274821 (-) 795 WP_014418368.1 YqhG family protein -
  BACVE_RS16760 (BACVE_003379) - 3274843..3276513 (-) 1671 WP_021494309.1 SNF2-related protein -
  BACVE_RS16765 (BACVE_003380) gcvT 3276937..3278037 (+) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=496313 BACVE_RS16750 WP_014418369.1 3273677..3273850(-) (sinI) [Bacillus velezensis strain NST6]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=496313 BACVE_RS16750 WP_014418369.1 3273677..3273850(-) (sinI) [Bacillus velezensis strain NST6]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719