Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   INQ56_RS14875 Genome accession   NZ_CP063360
Coordinates   2869798..2869938 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain BIM B-263     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2864798..2874938
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  INQ56_RS14850 (INQ56_14850) - 2865064..2865453 (-) 390 WP_017358943.1 hotdog fold thioesterase -
  INQ56_RS14855 (INQ56_14855) comA 2865477..2866118 (-) 642 WP_163116287.1 response regulator transcription factor Regulator
  INQ56_RS14860 (INQ56_14860) comP 2866199..2868511 (-) 2313 WP_041507704.1 ATP-binding protein Regulator
  INQ56_RS14865 (INQ56_14865) comX 2868565..2868735 (-) 171 WP_074041927.1 competence pheromone ComX -
  INQ56_RS14870 (INQ56_14870) - 2868732..2869646 (-) 915 WP_168948551.1 polyprenyl synthetase family protein -
  INQ56_RS14875 (INQ56_14875) degQ 2869798..2869938 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  INQ56_RS14880 (INQ56_14880) - 2870444..2870797 (+) 354 WP_017367963.1 hypothetical protein -
  INQ56_RS14885 (INQ56_14885) - 2870834..2872060 (-) 1227 WP_035701209.1 EAL and HDOD domain-containing protein -
  INQ56_RS14890 (INQ56_14890) - 2872201..2873670 (-) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  INQ56_RS14895 (INQ56_14895) - 2873688..2874239 (-) 552 WP_025207909.1 cysteine hydrolase family protein -
  INQ56_RS14900 (INQ56_14900) - 2874300..2874707 (-) 408 WP_007500468.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=494712 INQ56_RS14875 WP_003213123.1 2869798..2869938(-) (degQ) [Bacillus altitudinis strain BIM B-263]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=494712 INQ56_RS14875 WP_003213123.1 2869798..2869938(-) (degQ) [Bacillus altitudinis strain BIM B-263]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696