Detailed information    

insolico Bioinformatically predicted

Overview

Name   amiD   Type   Regulator
Locus tag   IM723_RS07010 Genome accession   NZ_CP063275
Coordinates   1355423..1356349 (-) Length   308 a.a.
NCBI ID   WP_002946409.1    Uniprot ID   -
Organism   Streptococcus thermophilus strain DMST-H2     
Function   internalize XIP (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1337871..1408261 1355423..1356349 within 0


Gene organization within MGE regions


Location: 1337871..1408261
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IM723_RS06925 liaF 1337879..1338577 (-) 699 WP_065972438.1 cell wall-active antibiotics response protein LiaF -
  IM723_RS10075 - 1338843..1338998 (-) 156 WP_244810375.1 ion channel -
  IM723_RS06935 stkP/pknB 1339635..1341506 (-) 1872 WP_014621795.1 Stk1 family PASTA domain-containing Ser/Thr kinase Regulator
  IM723_RS06940 - 1341506..1342243 (-) 738 WP_002946881.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  IM723_RS06945 rsmB 1342287..1343609 (-) 1323 WP_014608533.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -
  IM723_RS06950 fmt 1343599..1344534 (-) 936 WP_211836831.1 methionyl-tRNA formyltransferase -
  IM723_RS06955 - 1344552..1346948 (-) 2397 WP_211836832.1 primosomal protein N' -
  IM723_RS06960 rpoZ 1347090..1347404 (-) 315 WP_002951415.1 DNA-directed RNA polymerase subunit omega -
  IM723_RS06965 gmk 1347426..1348055 (-) 630 WP_011226296.1 guanylate kinase -
  IM723_RS06970 ftsY 1348288..1349679 (-) 1392 WP_011226297.1 signal recognition particle-docking protein FtsY -
  IM723_RS06975 - 1349693..1350508 (-) 816 WP_011227405.1 Cof-type HAD-IIB family hydrolase -
  IM723_RS06980 - 1350501..1351295 (-) 795 WP_084829753.1 HAD family hydrolase -
  IM723_RS06985 - 1351479..1351856 (+) 378 WP_011226300.1 GntR family transcriptional regulator -
  IM723_RS06990 - 1351861..1352559 (+) 699 WP_011226301.1 ABC transporter ATP-binding protein -
  IM723_RS06995 - 1352571..1353356 (+) 786 WP_176243303.1 ABC transporter permease -
  IM723_RS07000 amiF 1353406..1354335 (-) 930 WP_002951426.1 ATP-binding cassette domain-containing protein Regulator
  IM723_RS07005 amiE 1354328..1355413 (-) 1086 WP_211836833.1 ABC transporter ATP-binding protein Regulator
  IM723_RS07010 amiD 1355423..1356349 (-) 927 WP_002946409.1 oligopeptide ABC transporter permease OppC Regulator
  IM723_RS07015 amiC 1356349..1357842 (-) 1494 WP_002946410.1 ABC transporter permease Regulator
  IM723_RS07020 amiA 1357904..1359871 (-) 1968 WP_211836834.1 peptide ABC transporter substrate-binding protein Regulator
  IM723_RS07025 - 1360226..1361475 (+) 1250 Protein_1338 ISL3 family transposase -
  IM723_RS07030 amiA3 1361520..1363493 (-) 1974 WP_211836835.1 peptide ABC transporter substrate-binding protein Regulator
  IM723_RS07035 - 1363697..1363887 (-) 191 Protein_1340 IS3 family transposase -
  IM723_RS07040 - 1363881..1364282 (-) 402 Protein_1341 ABC transporter ATP-binding protein -
  IM723_RS07045 - 1364277..1364637 (-) 361 Protein_1342 TatD family hydrolase -
  IM723_RS07050 - 1364987..1366192 (+) 1206 WP_011227415.1 OFA family MFS transporter -
  IM723_RS07055 - 1366238..1367589 (-) 1352 Protein_1344 IS3 family transposase -
  IM723_RS07060 pta 1367675..1368658 (-) 984 WP_011226315.1 phosphate acetyltransferase -
  IM723_RS07065 - 1368672..1369568 (-) 897 WP_011226316.1 RluA family pseudouridine synthase -
  IM723_RS07070 - 1369565..1370401 (-) 837 WP_041827075.1 NAD kinase -
  IM723_RS07075 - 1370373..1371047 (-) 675 WP_002951443.1 GTP pyrophosphokinase family protein -
  IM723_RS07080 - 1371143..1371718 (+) 576 WP_002951444.1 CYTH domain-containing protein -
  IM723_RS07085 - 1372083..1373054 (+) 972 WP_002951446.1 ribose-phosphate diphosphokinase -
  IM723_RS07090 - 1373058..1374170 (+) 1113 WP_211836836.1 cysteine desulfurase family protein -
  IM723_RS07095 - 1374172..1374519 (+) 348 WP_002948028.1 DUF1831 domain-containing protein -
  IM723_RS07100 - 1374663..1375322 (+) 660 WP_211837048.1 redox-sensing transcriptional repressor Rex -
  IM723_RS07105 - 1375315..1376010 (+) 696 WP_011226323.1 gamma-glutamyl-gamma-aminobutyrate hydrolase family protein -
  IM723_RS07110 radC 1376063..1376749 (-) 687 WP_011226324.1 DNA repair protein RadC -
  IM723_RS07115 - 1376798..1378582 (-) 1785 WP_011226325.1 rhamnan synthesis F family protein -
  IM723_RS07120 - 1378579..1379634 (-) 1056 WP_002948022.1 glycosyltransferase -
  IM723_RS07125 - 1379654..1380859 (-) 1206 WP_011226326.1 ABC transporter ATP-binding protein -
  IM723_RS07130 - 1380859..1381668 (-) 810 WP_002948020.1 ABC transporter permease -
  IM723_RS07135 - 1381652..1382608 (-) 957 WP_011226328.1 glycosyltransferase family 2 protein -
  IM723_RS07140 - 1382605..1383753 (-) 1149 WP_041828290.1 glycosyltransferase family 1 protein -
  IM723_RS07145 - 1383862..1384872 (-) 1011 WP_011226330.1 glycosyltransferase family A protein -
  IM723_RS07150 - 1384872..1386146 (-) 1275 WP_011226331.1 lipopolysaccharide biosynthesis protein -
  IM723_RS07155 - 1386139..1386471 (-) 333 WP_011226332.1 DUF2304 domain-containing protein -
  IM723_RS07160 - 1386477..1387172 (-) 696 WP_173940715.1 glycosyltransferase family 2 protein -
  IM723_RS07165 rfbD 1387249..1388100 (-) 852 WP_014621820.1 dTDP-4-dehydrorhamnose reductase -
  IM723_RS07170 - 1388177..1389511 (-) 1335 WP_041828293.1 DUF6056 family protein -
  IM723_RS07175 - 1389624..1390544 (-) 921 WP_116920321.1 glycosyltransferase family 2 protein -
  IM723_RS07180 - 1390604..1392019 (-) 1416 WP_096811580.1 DUF2142 domain-containing protein -
  IM723_RS07185 - 1392353..1392688 (-) 336 WP_002891474.1 metal-sulfur cluster assembly factor -
  IM723_RS07190 rpoD 1392742..1393851 (-) 1110 WP_011226338.1 RNA polymerase sigma factor RpoD -
  IM723_RS07195 dnaG 1393855..1395666 (-) 1812 WP_011681448.1 DNA primase -
  IM723_RS07200 mscL 1395830..1396210 (+) 381 WP_211837049.1 large conductance mechanosensitive channel protein MscL -
  IM723_RS07205 rpsU 1396370..1396546 (-) 177 WP_082309068.1 30S ribosomal protein S21 -
  IM723_RS07210 - 1396741..1397535 (-) 795 WP_023909836.1 ABC transporter substrate-binding protein -
  IM723_RS07215 - 1397597..1398706 (-) 1110 WP_180481063.1 aminotransferase -
  IM723_RS07220 - 1399053..1399850 (-) 798 WP_141326473.1 transporter substrate-binding domain-containing protein -
  IM723_RS07225 - 1399847..1400677 (-) 831 WP_022097022.1 transporter substrate-binding domain-containing protein -
  IM723_RS07230 - 1400891..1401355 (-) 465 WP_011681454.1 8-oxo-dGTP diphosphatase -
  IM723_RS07235 uvrB 1401400..1403391 (-) 1992 WP_002953358.1 excinuclease ABC subunit UvrB -
  IM723_RS07240 - 1403538..1404005 (-) 468 WP_084829769.1 hypothetical protein -
  IM723_RS07245 - 1404078..1405014 (-) 937 Protein_1382 CPBP family glutamic-type intramembrane protease -
  IM723_RS07250 - 1405213..1407423 (+) 2211 WP_211836837.1 ABC transporter substrate-binding protein/permease -
  IM723_RS07255 - 1407423..1408163 (+) 741 WP_002945131.1 amino acid ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 308 a.a.        Molecular weight: 34694.85 Da        Isoelectric Point: 9.7054

>NTDB_id=494173 IM723_RS07010 WP_002946409.1 1355423..1356349(-) (amiD) [Streptococcus thermophilus strain DMST-H2]
MASIDKSKFQFVKRDDFASETIDAPSYSYWKSVMRQFFKKKSTVVMLGILITIILMSFIYPMFSKFDFNDVSKVNDFSLR
YVHPNAQYWFGTDGNGKSLFDSVWFGARNSILIAVIATFLNVIIGLLVGAVWGISKTFDMIMMEIYNIISNIPSLLVVIV
LTYSLGAGFWNMIFAMTVTGWIGIAYTIRIQIMRYRDLEYNLASRNLGTPTAKIVIKNIMPQLVSVIVTMASQLLPGFIS
YEAFLSYFGLGLPVTTPSLGRLISDYAQNVTVNAYLFWIPLTTLILVSLALFIVGQNLADASDPRTHR

Nucleotide


Download         Length: 927 bp        

>NTDB_id=494173 IM723_RS07010 WP_002946409.1 1355423..1356349(-) (amiD) [Streptococcus thermophilus strain DMST-H2]
ATGGCTTCAATTGATAAAAGTAAGTTCCAATTTGTAAAGCGCGATGATTTTGCCTCTGAAACAATTGATGCACCGTCTTA
CTCATACTGGAAATCAGTGATGCGTCAATTTTTTAAAAAGAAATCAACAGTTGTAATGTTGGGAATCTTGATTACTATTA
TTTTAATGAGTTTCATCTACCCAATGTTTTCTAAATTTGACTTCAATGATGTCTCAAAAGTAAATGATTTCAGTTTGCGT
TATGTACATCCAAACGCTCAATACTGGTTCGGTACTGACGGTAATGGTAAGTCTCTATTTGACAGTGTTTGGTTTGGGGC
TCGTAATTCTATCCTTATCGCTGTTATCGCTACCTTCCTGAATGTTATAATTGGTTTGCTTGTAGGTGCTGTTTGGGGGA
TTTCTAAGACCTTCGATATGATTATGATGGAAATCTACAACATCATCTCAAATATTCCCTCTCTCCTTGTGGTTATCGTC
TTGACTTACTCATTAGGTGCTGGTTTCTGGAATATGATTTTTGCCATGACCGTAACAGGTTGGATCGGTATTGCCTATAC
AATCCGTATTCAAATCATGCGTTATCGTGATTTGGAGTATAACTTGGCTTCTCGCAATTTGGGAACACCAACGGCTAAGA
TTGTGATTAAAAATATTATGCCACAACTTGTGTCAGTTATTGTAACCATGGCTAGTCAACTTTTGCCAGGATTTATCTCT
TATGAGGCCTTCCTTTCATACTTTGGTTTGGGTCTTCCTGTTACTACGCCTAGTCTTGGTCGTTTGATTTCAGATTATGC
ACAGAACGTTACAGTCAATGCCTATCTCTTCTGGATTCCATTGACTACCTTGATTCTTGTTTCTCTTGCCCTCTTTATTG
TTGGTCAAAACTTAGCGGATGCTAGTGACCCACGTACGCATAGATAG

Domains

Predicted by InterproScan.

N-terminal TM domain of oligopeptide transport permease C (OppC_N)

(28-71)

Binding-protein-dependent transport system inner membrane component (BPD_transp_1)

(125-306)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  amiD Streptococcus thermophilus LMG 18311

100

100

1
  amiD Streptococcus thermophilus LMD-9

100

100

1
  amiD Streptococcus salivarius strain HSISS4

96.429

100

0.964