Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   IMZ18_RS05815 Genome accession   NZ_CP063151
Coordinates   1084171..1084344 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis strain CMIN-4     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1079171..1089344
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IMZ18_RS05770 (IMZ18_05770) comGE 1079522..1079869 (+) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  IMZ18_RS05775 (IMZ18_05775) comGF 1079895..1080278 (+) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  IMZ18_RS05780 (IMZ18_05780) comGG 1080279..1080653 (+) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  IMZ18_RS05785 (IMZ18_05785) spoIITA 1080724..1080903 (+) 180 WP_014480252.1 YqzE family protein -
  IMZ18_RS05790 (IMZ18_05790) yqzG 1080945..1081271 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  IMZ18_RS05795 (IMZ18_05795) tapA 1081543..1082304 (+) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  IMZ18_RS05800 (IMZ18_05800) sipW 1082288..1082860 (+) 573 WP_003230181.1 signal peptidase I SipW -
  IMZ18_RS05805 (IMZ18_05805) tasA 1082924..1083709 (+) 786 WP_014480250.1 biofilm matrix protein TasA -
  IMZ18_RS05810 (IMZ18_05810) sinR 1083802..1084137 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  IMZ18_RS05815 (IMZ18_05815) sinI 1084171..1084344 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  IMZ18_RS05820 (IMZ18_05820) yqhG 1084527..1085321 (-) 795 WP_014480249.1 YqhG family protein -
  IMZ18_RS05825 (IMZ18_05825) hepAA 1085342..1087015 (-) 1674 WP_014480248.1 SNF2-related protein -
  IMZ18_RS05830 (IMZ18_05830) gcvT 1087457..1088545 (+) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=493464 IMZ18_RS05815 WP_003230187.1 1084171..1084344(-) (sinI) [Bacillus subtilis subsp. subtilis strain CMIN-4]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=493464 IMZ18_RS05815 WP_003230187.1 1084171..1084344(-) (sinI) [Bacillus subtilis subsp. subtilis strain CMIN-4]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1