Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   IMY14_RS13150 Genome accession   NZ_CP063150
Coordinates   2533755..2533928 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain s-16     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2528755..2538928
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IMY14_RS13135 gcvT 2529554..2530642 (-) 1089 WP_015384081.1 glycine cleavage system aminomethyltransferase GcvT -
  IMY14_RS13140 hepAA 2531084..2532757 (+) 1674 WP_047182869.1 DEAD/DEAH box helicase -
  IMY14_RS13145 yqhG 2532778..2533572 (+) 795 WP_003230200.1 YqhG family protein -
  IMY14_RS13150 sinI 2533755..2533928 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  IMY14_RS13155 sinR 2533962..2534297 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  IMY14_RS13160 tasA 2534390..2535175 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  IMY14_RS13165 sipW 2535239..2535811 (-) 573 WP_080030740.1 signal peptidase I SipW -
  IMY14_RS13170 tapA 2535795..2536556 (-) 762 WP_047182870.1 amyloid fiber anchoring/assembly protein TapA -
  IMY14_RS13175 yqzG 2536826..2537152 (+) 327 WP_047183570.1 YqzG/YhdC family protein -
  IMY14_RS13180 spoIITA 2537194..2537373 (-) 180 WP_003230176.1 YqzE family protein -
  IMY14_RS13185 comGG 2537445..2537819 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  IMY14_RS13190 comGF 2537820..2538203 (-) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  IMY14_RS13195 comGE 2538229..2538576 (-) 348 WP_047182872.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=493398 IMY14_RS13150 WP_003230187.1 2533755..2533928(+) (sinI) [Bacillus subtilis strain s-16]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=493398 IMY14_RS13150 WP_003230187.1 2533755..2533928(+) (sinI) [Bacillus subtilis strain s-16]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1