Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   SPNINV200_RS02545 Genome accession   NC_017593
Coordinates   481613..481762 (+) Length   49 a.a.
NCBI ID   WP_001813641.1    Uniprot ID   A0A6I3TPS6
Organism   Streptococcus pneumoniae INV200     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 479889..480694 481613..481762 flank 919


Gene organization within MGE regions


Location: 479889..481762
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SPNINV200_RS11475 - 479889..480694 (+) 806 Protein_477 IS5 family transposase -
  SPNINV200_RS02535 (SPNINV200_04750) blpM 480896..481150 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  SPNINV200_RS02540 (SPNINV200_04760) blpN 481166..481369 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  SPNINV200_RS02545 cipB 481613..481762 (+) 150 WP_001813641.1 bacteriocin-like peptide BlpO Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5164.93 Da        Isoelectric Point: 3.9133

>NTDB_id=49306 SPNINV200_RS02545 WP_001813641.1 481613..481762(+) (cipB) [Streptococcus pneumoniae INV200]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=49306 SPNINV200_RS02545 WP_001813641.1 481613..481762(+) (cipB) [Streptococcus pneumoniae INV200]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-41)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I3TPS6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

48.98

100

0.49

Multiple sequence alignment