Detailed information NTG0049226

Bioinformatically predicted

Overview

• Name: cipB
• Type: Regulator
• Locus tag: SPNOXC_RS02675
• Genome accession: NC_017592
• Coordinates: 496335..496484 (+)
• Length: 49 a.a.
• NCBI ID: WP_001808912.1
• Uniprot ID: A0A4J1ZTW6
• Organism: Streptococcus pneumoniae OXC141
• Function: indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	485845..495389	496335..496484	flank	946

Gene organization within MGE regions

Location: 485845..496484

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SPNOXC_RS02610 (SPNOXC04810)	-	485845..486132 (-)	288	WP_000777760.1	hypothetical protein	-
SPNOXC_RS02615 (SPNOXC04820)	-	486142..486552 (-)	411	WP_001278301.1	HIT family protein	-
SPNOXC_RS02620 (SPNOXC04830)	pptA	486620..487351 (+)	732	WP_000889923.1	ABC transporter ATP-binding protein	Regulator
SPNOXC_RS02625 (SPNOXC04840)	-	487348..488397 (+)	1050	WP_000653752.1	ABC transporter permease	-
SPNOXC_RS02630 (SPNOXC04850)	-	488565..488894 (-)	330	WP_000132570.1	hypothetical protein	-
SPNOXC_RS02635 (SPNOXC04860)	-	489170..489508 (+)	339	WP_000682119.1	LytTR family DNA-binding domain-containing protein	-
SPNOXC_RS02640 (SPNOXC04870)	comE/blpR	489513..490250 (+)	738	WP_001219127.1	response regulator transcription factor	Regulator
SPNOXC_RS02645 (SPNOXC04880)	-	490264..491604 (+)	1341	WP_001017622.1	sensor histidine kinase	-
SPNOXC_RS02650 (SPNOXC04890)	blpC	491646..491801 (-)	156	WP_000358813.1	quorum-sensing system pheromone BlpC	-
SPNOXC_RS02655 (SPNOXC04900)	-	491858..493219 (-)	1362	WP_001069092.1	bacteriocin secretion accessory protein	-
SPNOXC_RS13400	comA/nlmT	493230..493718 (-)	489	WP_307774349.1	ATP-binding cassette domain-containing protein	Regulator
SPNOXC_RS13405	comA/nlmT	493702..494142 (-)	441	WP_001808911.1	ATP-binding cassette domain-containing protein	Regulator
SPNOXC_RS13410	comA/nlmT	494132..494857 (-)	726	WP_167750760.1	ABC transporter transmembrane domain-containing protein	Regulator
SPNOXC_RS13415 (SPNOXC04920)	comA/nlmT	494802..495389 (-)	588	WP_000205166.1	cysteine peptidase family C39 domain-containing protein	Regulator
SPNOXC_RS02670 (SPNOXC04930)	blpI	495671..495868 (+)	198	WP_001093258.1	bacteriocin-like peptide BlpI	-
SPNOXC_RS02675	cipB	496335..496484 (+)	150	WP_001808912.1	bacteriocin-like peptide BlpO	Regulator

Sequence

Protein

• Length: 49 a.a.
• Molecular weight: 5150.86 Da
• Isoelectric Point: 3.7098

>NTDB_id=49226 SPNOXC_RS02675 WP_001808912.1 496335..496484(+) (cipB) [Streptococcus pneumoniae OXC141]
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV

Nucleotide

• Length: 150 bp

>NTDB_id=49226 SPNOXC_RS02675 WP_001808912.1 496335..496484(+) (cipB) [Streptococcus pneumoniae OXC141]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

• Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc) (6-41)

3D structure

• AlphaFold DB: A0A4J1ZTW6

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
cipB	Streptococcus mutans UA159	51.02	100	0.51