Detailed information
Overview
| Name | cipB | Type | Regulator |
| Locus tag | SPNOXC_RS02675 | Genome accession | NC_017592 |
| Coordinates | 496335..496484 (+) | Length | 49 a.a. |
| NCBI ID | WP_001808912.1 | Uniprot ID | A0A4J1ZTW6 |
| Organism | Streptococcus pneumoniae OXC141 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 485845..495389 | 496335..496484 | flank | 946 |
Gene organization within MGE regions
Location: 485845..496484
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPNOXC_RS02610 (SPNOXC04810) | - | 485845..486132 (-) | 288 | WP_000777760.1 | hypothetical protein | - |
| SPNOXC_RS02615 (SPNOXC04820) | - | 486142..486552 (-) | 411 | WP_001278301.1 | HIT family protein | - |
| SPNOXC_RS02620 (SPNOXC04830) | pptA | 486620..487351 (+) | 732 | WP_000889923.1 | ABC transporter ATP-binding protein | Regulator |
| SPNOXC_RS02625 (SPNOXC04840) | - | 487348..488397 (+) | 1050 | WP_000653752.1 | ABC transporter permease | - |
| SPNOXC_RS02630 (SPNOXC04850) | - | 488565..488894 (-) | 330 | WP_000132570.1 | hypothetical protein | - |
| SPNOXC_RS02635 (SPNOXC04860) | - | 489170..489508 (+) | 339 | WP_000682119.1 | LytTR family DNA-binding domain-containing protein | - |
| SPNOXC_RS02640 (SPNOXC04870) | comE/blpR | 489513..490250 (+) | 738 | WP_001219127.1 | response regulator transcription factor | Regulator |
| SPNOXC_RS02645 (SPNOXC04880) | - | 490264..491604 (+) | 1341 | WP_001017622.1 | sensor histidine kinase | - |
| SPNOXC_RS02650 (SPNOXC04890) | blpC | 491646..491801 (-) | 156 | WP_000358813.1 | quorum-sensing system pheromone BlpC | - |
| SPNOXC_RS02655 (SPNOXC04900) | - | 491858..493219 (-) | 1362 | WP_001069092.1 | bacteriocin secretion accessory protein | - |
| SPNOXC_RS13400 | comA/nlmT | 493230..493718 (-) | 489 | WP_307774349.1 | ATP-binding cassette domain-containing protein | Regulator |
| SPNOXC_RS13405 | comA/nlmT | 493702..494142 (-) | 441 | WP_001808911.1 | ATP-binding cassette domain-containing protein | Regulator |
| SPNOXC_RS13410 | comA/nlmT | 494132..494857 (-) | 726 | WP_167750760.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| SPNOXC_RS13415 (SPNOXC04920) | comA/nlmT | 494802..495389 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| SPNOXC_RS02670 (SPNOXC04930) | blpI | 495671..495868 (+) | 198 | WP_001093258.1 | bacteriocin-like peptide BlpI | - |
| SPNOXC_RS02675 | cipB | 496335..496484 (+) | 150 | WP_001808912.1 | bacteriocin-like peptide BlpO | Regulator |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5150.86 Da Isoelectric Point: 3.7098
>NTDB_id=49226 SPNOXC_RS02675 WP_001808912.1 496335..496484(+) (cipB) [Streptococcus pneumoniae OXC141]
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=49226 SPNOXC_RS02675 WP_001808912.1 496335..496484(+) (cipB) [Streptococcus pneumoniae OXC141]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |