Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | KHA81_RS11950 | Genome accession | NZ_CP074391 |
| Coordinates | 2488359..2488532 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain L-17 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2483359..2493532
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KHA81_RS11935 | gcvT | 2484177..2485277 (-) | 1101 | WP_015388009.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| KHA81_RS11940 | - | 2485700..2487370 (+) | 1671 | WP_003153107.1 | SNF2-related protein | - |
| KHA81_RS11945 | - | 2487388..2488182 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| KHA81_RS11950 | sinI | 2488359..2488532 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| KHA81_RS11955 | sinR | 2488566..2488901 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| KHA81_RS11960 | tasA | 2488949..2489734 (-) | 786 | WP_015388008.1 | biofilm matrix protein TasA | - |
| KHA81_RS11965 | sipW | 2489798..2490382 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| KHA81_RS11970 | tapA | 2490354..2491025 (-) | 672 | WP_015388007.1 | amyloid fiber anchoring/assembly protein TapA | - |
| KHA81_RS11975 | - | 2491285..2491614 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| KHA81_RS11980 | - | 2491654..2491833 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| KHA81_RS11985 | comGG | 2491890..2492267 (-) | 378 | WP_015388005.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| KHA81_RS11990 | comGF | 2492268..2492768 (-) | 501 | WP_225879914.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| KHA81_RS11995 | comGE | 2492677..2492991 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| KHA81_RS12000 | comGD | 2492975..2493412 (-) | 438 | WP_015388002.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=491208 KHA81_RS11950 WP_003153105.1 2488359..2488532(+) (sinI) [Bacillus amyloliquefaciens strain L-17]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=491208 KHA81_RS11950 WP_003153105.1 2488359..2488532(+) (sinI) [Bacillus amyloliquefaciens strain L-17]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |