Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   KHA81_RS02220 Genome accession   NZ_CP074391
Coordinates   435475..435594 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   A7Z1C5
Organism   Bacillus amyloliquefaciens strain L-17     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 430475..440594
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KHA81_RS02205 - 432087..432770 (+) 684 WP_015388707.1 response regulator transcription factor -
  KHA81_RS02210 - 432757..434190 (+) 1434 WP_161625271.1 HAMP domain-containing sensor histidine kinase -
  KHA81_RS02215 rapC 434343..435491 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  KHA81_RS02220 phrC 435475..435594 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  KHA81_RS02225 - 435744..435839 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  KHA81_RS02230 - 435934..437298 (-) 1365 WP_014304341.1 aspartate kinase -
  KHA81_RS02235 ceuB 437713..438666 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  KHA81_RS02240 - 438656..439603 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  KHA81_RS02245 - 439597..440355 (+) 759 WP_015388706.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=491139 KHA81_RS02220 WP_003156334.1 435475..435594(+) (phrC) [Bacillus amyloliquefaciens strain L-17]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=491139 KHA81_RS02220 WP_003156334.1 435475..435594(+) (phrC) [Bacillus amyloliquefaciens strain L-17]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z1C5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718