Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   K751_RS07090 Genome accession   NC_021218
Coordinates   1474421..1474546 (-) Length   41 a.a.
NCBI ID   WP_001217865.1    Uniprot ID   -
Organism   Helicobacter pylori UM066     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1469421..1479546
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K751_RS07070 (K751_00885) - 1470108..1471520 (-) 1413 WP_015642327.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  K751_RS07075 (K751_00880) comB10 1471590..1472726 (-) 1137 WP_015642326.1 DNA type IV secretion system protein ComB10 Machinery gene
  K751_RS07080 (K751_00875) comB9 1472719..1473681 (-) 963 WP_015642325.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  K751_RS07085 (K751_00870) comB8 1473681..1474424 (-) 744 WP_000660524.1 virB8 family protein Machinery gene
  K751_RS07090 (K751_08960) comB7 1474421..1474546 (-) 126 WP_001217865.1 hypothetical protein Machinery gene
  K751_RS07095 (K751_00865) comB6 1474562..1475617 (-) 1056 WP_015642324.1 P-type conjugative transfer protein TrbL Machinery gene
  K751_RS07100 (K751_00860) - 1475625..1476620 (-) 996 WP_015642323.1 PDZ domain-containing protein -
  K751_RS07105 (K751_00855) - 1476620..1476913 (-) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  K751_RS07110 (K751_00850) panD 1476924..1477274 (-) 351 WP_000142213.1 aspartate 1-decarboxylase -
  K751_RS07115 (K751_00845) - 1477264..1479486 (-) 2223 WP_015642322.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4794.82 Da        Isoelectric Point: 9.3278

>NTDB_id=48847 K751_RS07090 WP_001217865.1 1474421..1474546(-) (comB7) [Helicobacter pylori UM066]
MRIFFVIIGLILFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=48847 K751_RS07090 WP_001217865.1 1474421..1474546(-) (comB7) [Helicobacter pylori UM066]
ATGAGAATTTTTTTTGTTATTATTGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829


Multiple sequence alignment