Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   IEN91_RS15845 Genome accession   NZ_CP061938
Coordinates   3204029..3204169 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain FIO1408     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3199029..3209169
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IEN91_RS15820 (IEN91_15820) - 3199369..3199752 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  IEN91_RS15825 (IEN91_15825) comA 3199774..3200418 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  IEN91_RS15830 (IEN91_15830) comP 3200499..3202790 (-) 2292 WP_014305719.1 histidine kinase Regulator
  IEN91_RS15835 (IEN91_15835) comX 3202802..3202966 (-) 165 WP_007613432.1 competence pheromone ComX -
  IEN91_RS15840 (IEN91_15840) - 3202966..3203877 (-) 912 WP_196616642.1 polyprenyl synthetase family protein -
  IEN91_RS15845 (IEN91_15845) degQ 3204029..3204169 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  IEN91_RS15850 (IEN91_15850) - 3204635..3204976 (+) 342 WP_014305721.1 hypothetical protein -
  IEN91_RS15855 (IEN91_15855) - 3204983..3206203 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  IEN91_RS15860 (IEN91_15860) - 3206333..3207799 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  IEN91_RS15865 (IEN91_15865) - 3207817..3208368 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  IEN91_RS15870 (IEN91_15870) - 3208465..3208863 (-) 399 WP_196616085.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=485615 IEN91_RS15845 WP_003152043.1 3204029..3204169(-) (degQ) [Bacillus velezensis strain FIO1408]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=485615 IEN91_RS15845 WP_003152043.1 3204029..3204169(-) (degQ) [Bacillus velezensis strain FIO1408]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891