Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   J9312_RS12530 Genome accession   NZ_CP072845
Coordinates   2337917..2338090 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain XP     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2332917..2343090
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J9312_RS12515 (J9312_12435) gcvT 2333716..2334804 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  J9312_RS12520 (J9312_12440) hepAA 2335246..2336919 (+) 1674 WP_014480248.1 DEAD/DEAH box helicase -
  J9312_RS12525 (J9312_12445) yqhG 2336940..2337734 (+) 795 WP_264379318.1 YqhG family protein -
  J9312_RS12530 (J9312_12450) sinI 2337917..2338090 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  J9312_RS12535 (J9312_12455) sinR 2338124..2338459 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  J9312_RS12540 (J9312_12460) tasA 2338552..2339337 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  J9312_RS12545 (J9312_12465) sipW 2339401..2339973 (-) 573 WP_003230181.1 signal peptidase I SipW -
  J9312_RS12550 (J9312_12470) tapA 2339957..2340718 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  J9312_RS12555 (J9312_12475) yqzG 2340990..2341316 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  J9312_RS12560 (J9312_12480) spoIITA 2341358..2341537 (-) 180 WP_014480252.1 YqzE family protein -
  J9312_RS12565 (J9312_12485) comGG 2341608..2341982 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  J9312_RS12570 (J9312_12490) comGF 2341983..2342366 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  J9312_RS12575 (J9312_12495) comGE 2342392..2342739 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=485478 J9312_RS12530 WP_003230187.1 2337917..2338090(+) (sinI) [Bacillus subtilis strain XP]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=485478 J9312_RS12530 WP_003230187.1 2337917..2338090(+) (sinI) [Bacillus subtilis strain XP]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1