Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   IE382_RS15450 Genome accession   NZ_CP061870
Coordinates   2846707..2846880 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain FX-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2841707..2851880
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IE382_RS15435 (IE382_15370) gcvT 2842507..2843595 (-) 1089 WP_017696204.1 glycine cleavage system aminomethyltransferase GcvT -
  IE382_RS15440 (IE382_15375) yqhH 2844036..2845709 (+) 1674 WP_017696203.1 SNF2-related protein -
  IE382_RS15445 (IE382_15380) yqhG 2845730..2846524 (+) 795 WP_017696202.1 YqhG family protein -
  IE382_RS15450 (IE382_15385) sinI 2846707..2846880 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  IE382_RS15455 (IE382_15390) sinR 2846914..2847249 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  IE382_RS15460 (IE382_15395) tasA 2847342..2848127 (-) 786 WP_017696201.1 biofilm matrix protein TasA -
  IE382_RS15465 (IE382_15400) sipW 2848192..2848764 (-) 573 WP_072557060.1 signal peptidase I -
  IE382_RS15470 (IE382_15405) tapA 2848748..2849503 (-) 756 WP_017696199.1 amyloid fiber anchoring/assembly protein TapA -
  IE382_RS15475 (IE382_15410) yqzG 2849774..2850100 (+) 327 WP_026113671.1 YqzG/YhdC family protein -
  IE382_RS15480 (IE382_15415) spoIIT 2850142..2850321 (-) 180 WP_014480252.1 YqzE family protein -
  IE382_RS15485 (IE382_15420) comGG 2850392..2850766 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  IE382_RS15490 (IE382_15425) comGF 2850767..2851150 (-) 384 WP_041334965.1 ComG operon protein ComGF Machinery gene
  IE382_RS15495 (IE382_15430) comGE 2851176..2851523 (-) 348 WP_041334967.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=485442 IE382_RS15450 WP_003230187.1 2846707..2846880(+) (sinI) [Bacillus subtilis strain FX-1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=485442 IE382_RS15450 WP_003230187.1 2846707..2846880(+) (sinI) [Bacillus subtilis strain FX-1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1