Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   BAINH2_RS01980 Genome accession   NZ_CP061852
Coordinates   429608..429727 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus amyloliquefaciens strain INH2-4b     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 424608..434727
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAINH2_RS01965 (BAINH2_01965) - 426220..426903 (+) 684 WP_007410267.1 response regulator transcription factor -
  BAINH2_RS01970 (BAINH2_01970) - 426890..428323 (+) 1434 WP_162782989.1 HAMP domain-containing sensor histidine kinase -
  BAINH2_RS01975 (BAINH2_01975) rapC 428476..429624 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  BAINH2_RS01980 (BAINH2_01980) phrC 429608..429727 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  BAINH2_RS01985 (BAINH2_01985) - 429876..429986 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  BAINH2_RS01990 (BAINH2_01990) - 430066..431430 (-) 1365 WP_033575080.1 aspartate kinase -
  BAINH2_RS01995 (BAINH2_01995) ceuB 431844..432797 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  BAINH2_RS02000 (BAINH2_02000) - 432787..433734 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  BAINH2_RS02005 (BAINH2_02005) - 433728..434486 (+) 759 WP_053573731.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=485180 BAINH2_RS01980 WP_003156334.1 429608..429727(+) (phrC) [Bacillus amyloliquefaciens strain INH2-4b]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=485180 BAINH2_RS01980 WP_003156334.1 429608..429727(+) (phrC) [Bacillus amyloliquefaciens strain INH2-4b]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718