Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ID168_RS14520 Genome accession   NZ_CP061704
Coordinates   2975080..2975220 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain Y4_39     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2970080..2980220
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ID168_RS14495 (ID168_14495) - 2970421..2970804 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  ID168_RS14500 (ID168_14500) comA 2970826..2971470 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ID168_RS14505 (ID168_14505) comP 2971550..2973841 (-) 2292 WP_094247540.1 histidine kinase Regulator
  ID168_RS14510 (ID168_14510) comX 2973853..2974017 (-) 165 WP_007613432.1 competence pheromone ComX -
  ID168_RS14515 (ID168_14515) - 2974017..2974928 (-) 912 WP_031378407.1 polyprenyl synthetase family protein -
  ID168_RS14520 (ID168_14520) degQ 2975080..2975220 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ID168_RS14525 (ID168_14525) - 2975685..2976026 (+) 342 WP_014305721.1 hypothetical protein -
  ID168_RS14530 (ID168_14530) - 2976033..2977253 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  ID168_RS14535 (ID168_14535) - 2977383..2978849 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  ID168_RS14540 (ID168_14540) - 2978867..2979418 (-) 552 WP_146275407.1 cysteine hydrolase family protein -
  ID168_RS14545 (ID168_14545) - 2979515..2979913 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=484318 ID168_RS14520 WP_003152043.1 2975080..2975220(-) (degQ) [Bacillus velezensis strain Y4_39]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=484318 ID168_RS14520 WP_003152043.1 2975080..2975220(-) (degQ) [Bacillus velezensis strain Y4_39]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891