Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   J8G07_RS01780 Genome accession   NZ_CP072612
Coordinates   346531..346650 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   A7Z1C5
Organism   Bacillus amyloliquefaciens strain G10     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 341531..351650
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J8G07_RS01755 - 341770..342528 (-) 759 WP_007609404.1 ABC transporter ATP-binding protein -
  J8G07_RS01760 - 342522..343469 (-) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  J8G07_RS01765 ceuB 343459..344412 (-) 954 WP_032872883.1 ABC transporter permease Machinery gene
  J8G07_RS01770 - 344826..346190 (+) 1365 WP_007609394.1 aspartate kinase -
  J8G07_RS01775 - 346285..346380 (+) 96 WP_021495118.1 YjcZ family sporulation protein -
  J8G07_RS01780 phrC 346531..346650 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  J8G07_RS01785 rapC 346634..347782 (-) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  J8G07_RS01790 - 347935..349368 (-) 1434 WP_161503657.1 HAMP domain-containing sensor histidine kinase -
  J8G07_RS01795 - 349355..350038 (-) 684 WP_032872879.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=484313 J8G07_RS01780 WP_003156334.1 346531..346650(-) (phrC) [Bacillus amyloliquefaciens strain G10]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=484313 J8G07_RS01780 WP_003156334.1 346531..346650(-) (phrC) [Bacillus amyloliquefaciens strain G10]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGAGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z1C5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718