Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   IAU66_RS01970 Genome accession   NZ_CP061168
Coordinates   421016..421135 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus amyloliquefaciens strain T-5     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 416016..426135
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IAU66_RS01955 - 417628..418311 (+) 684 WP_024084885.1 response regulator transcription factor -
  IAU66_RS01960 - 418298..419731 (+) 1434 WP_161625271.1 HAMP domain-containing sensor histidine kinase -
  IAU66_RS01965 rapC 419884..421032 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  IAU66_RS01970 phrC 421016..421135 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  IAU66_RS01975 - 421285..421395 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  IAU66_RS01980 - 421475..422839 (-) 1365 WP_003156333.1 aspartate kinase -
  IAU66_RS01985 ceuB 423254..424207 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  IAU66_RS01990 - 424197..425144 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  IAU66_RS01995 - 425138..425896 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=481044 IAU66_RS01970 WP_003156334.1 421016..421135(+) (phrC) [Bacillus amyloliquefaciens strain T-5]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=481044 IAU66_RS01970 WP_003156334.1 421016..421135(+) (phrC) [Bacillus amyloliquefaciens strain T-5]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718