Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   J5X95_RS11210 Genome accession   NZ_CP072120
Coordinates   2210108..2210227 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   A7Z1C5
Organism   Bacillus amyloliquefaciens strain GKT04     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 2205108..2215227
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J5X95_RS11195 (J5X95_11195) - 2206720..2207403 (+) 684 WP_007410267.1 response regulator transcription factor -
  J5X95_RS11200 (J5X95_11200) - 2207390..2208823 (+) 1434 WP_020955322.1 ATP-binding protein -
  J5X95_RS11205 (J5X95_11205) rapC 2208976..2210124 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  J5X95_RS11210 (J5X95_11210) phrC 2210108..2210227 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  J5X95_RS11215 (J5X95_11215) - 2210375..2210485 (-) 111 WP_369878517.1 YjcZ family sporulation protein -
  J5X95_RS11220 (J5X95_11220) - 2210565..2211929 (-) 1365 WP_020955323.1 aspartate kinase -
  J5X95_RS11225 (J5X95_11225) ceuB 2212343..2213296 (+) 954 WP_059366593.1 ABC transporter permease Machinery gene
  J5X95_RS11230 (J5X95_11230) - 2213286..2214233 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  J5X95_RS11235 (J5X95_11235) - 2214227..2214985 (+) 759 WP_012116804.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=480769 J5X95_RS11210 WP_003156334.1 2210108..2210227(+) (phrC) [Bacillus amyloliquefaciens strain GKT04]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=480769 J5X95_RS11210 WP_003156334.1 2210108..2210227(+) (phrC) [Bacillus amyloliquefaciens strain GKT04]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z1C5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718