Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   J4T92_RS00200 Genome accession   NZ_CP071975
Coordinates   37377..37490 (+) Length   37 a.a.
NCBI ID   WP_001217877.1    Uniprot ID   -
Organism   Helicobacter pylori strain MT5118     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32377..42490
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J4T92_RS00175 (J4T92_00175) - 32418..34646 (+) 2229 WP_209553006.1 ATP-dependent Clp protease ATP-binding subunit -
  J4T92_RS00180 (J4T92_00180) panD 34636..34989 (+) 354 WP_209553007.1 aspartate 1-decarboxylase -
  J4T92_RS00185 (J4T92_00185) - 34992..35294 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  J4T92_RS00190 (J4T92_00190) - 35294..36298 (+) 1005 WP_209553430.1 PDZ domain-containing protein -
  J4T92_RS00195 (J4T92_00195) comB6 36306..37361 (+) 1056 WP_209553008.1 P-type conjugative transfer protein TrbL Machinery gene
  J4T92_RS00200 (J4T92_00200) comB7 37377..37490 (+) 114 WP_001217877.1 hypothetical protein Machinery gene
  J4T92_RS00205 (J4T92_00205) comB8 37487..38230 (+) 744 WP_209553009.1 virB8 family protein Machinery gene
  J4T92_RS00210 (J4T92_00210) comB9 38230..39216 (+) 987 WP_209553010.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  J4T92_RS00215 (J4T92_00215) comB10 39209..40339 (+) 1131 WP_209553011.1 DNA type IV secretion system protein ComB10 Machinery gene
  J4T92_RS00220 (J4T92_00220) - 40409..41821 (+) 1413 WP_209553012.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4291.23 Da        Isoelectric Point: 9.3572

>NTDB_id=480063 J4T92_RS00200 WP_001217877.1 37377..37490(+) (comB7) [Helicobacter pylori strain MT5118]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=480063 J4T92_RS00200 WP_001217877.1 37377..37490(+) (comB7) [Helicobacter pylori strain MT5118]
ATGAGGATTTTTTTTGTTATTATGGGACTTGTGCTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAGAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973