Detailed information    

insolico Bioinformatically predicted

Overview


Name   sepM   Type   Regulator
Locus tag   IBC03_RS07980 Genome accession   NZ_CP061025
Coordinates   1545524..1546600 (-) Length   358 a.a.
NCBI ID   WP_011681549.1    Uniprot ID   -
Organism   Streptococcus thermophilus strain 13496     
Function   processing of CSP (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1530780..1603585 1545524..1546600 within 0


Gene organization within MGE regions


Location: 1530780..1603585
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IBC03_RS07905 (IBC03_07925) - 1531671..1532222 (-) 552 WP_002946999.1 isochorismatase family cysteine hydrolase -
  IBC03_RS07910 (IBC03_07930) codY 1532285..1533070 (-) 786 WP_002951720.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  IBC03_RS07915 (IBC03_07935) - 1533330..1534544 (-) 1215 WP_002951721.1 pyridoxal phosphate-dependent aminotransferase -
  IBC03_RS07920 (IBC03_07940) - 1534899..1535351 (+) 453 WP_002946987.1 universal stress protein -
  IBC03_RS07925 (IBC03_07945) - 1535531..1536102 (+) 572 Protein_1520 IS30 family transposase -
  IBC03_RS07930 (IBC03_07950) - 1536174..1536347 (-) 174 WP_011681546.1 hypothetical protein -
  IBC03_RS07935 (IBC03_07955) - 1536408..1536782 (-) 375 WP_011681547.1 membrane protein -
  IBC03_RS07940 (IBC03_07960) pflA 1536994..1537794 (-) 801 WP_071417327.1 pyruvate formate-lyase-activating protein -
  IBC03_RS07945 (IBC03_07965) - 1537982..1538092 (-) 111 WP_014621906.1 LPXTG cell wall anchor domain-containing protein -
  IBC03_RS07950 (IBC03_07970) - 1538790..1540121 (-) 1332 WP_024703987.1 hemolysin family protein -
  IBC03_RS07955 (IBC03_07975) - 1540235..1541017 (+) 783 WP_024703988.1 ABC transporter ATP-binding protein -
  IBC03_RS07960 (IBC03_07980) - 1541636..1543702 (-) 2067 WP_138496610.1 sodium:proton antiporter -
  IBC03_RS07965 (IBC03_07985) - 1543711..1543953 (-) 243 WP_084830769.1 hypothetical protein -
  IBC03_RS07970 (IBC03_07990) - 1543950..1544498 (-) 549 WP_011226462.1 class I SAM-dependent methyltransferase -
  IBC03_RS07975 (IBC03_07995) - 1544495..1545439 (-) 945 WP_138496612.1 TIGR01212 family radical SAM protein -
  IBC03_RS07980 (IBC03_08000) sepM 1545524..1546600 (-) 1077 WP_011681549.1 SepM family pheromone-processing serine protease Regulator
  IBC03_RS07985 (IBC03_08005) coaD 1546578..1547075 (-) 498 WP_011681550.1 pantetheine-phosphate adenylyltransferase -
  IBC03_RS07990 (IBC03_08010) rsmD 1547109..1547708 (-) 600 Protein_1533 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD -
  IBC03_RS07995 (IBC03_08015) trxB 1547799..1548752 (-) 954 WP_259699870.1 thioredoxin-disulfide reductase -
  IBC03_RS08000 (IBC03_08020) - 1548785..1549009 (-) 225 WP_082309114.1 DUF4059 family protein -
  IBC03_RS08005 (IBC03_08025) - 1549224..1549967 (-) 744 WP_011681551.1 amino acid ABC transporter ATP-binding protein -
  IBC03_RS08010 (IBC03_08030) - 1549967..1550713 (-) 747 WP_095559509.1 amino acid ABC transporter permease -
  IBC03_RS08015 (IBC03_08035) - 1551109..1551939 (-) 831 WP_014608653.1 transporter substrate-binding domain-containing protein -
  IBC03_RS08020 (IBC03_08040) - 1552399..1552632 (-) 234 WP_002947030.1 hypothetical protein -
  IBC03_RS08025 (IBC03_08045) dinB 1552930..1554033 (-) 1104 WP_014608654.1 DNA polymerase IV -
  IBC03_RS08030 (IBC03_08050) pflB 1554312..1556621 (+) 2310 WP_138496614.1 formate C-acetyltransferase -
  IBC03_RS08035 (IBC03_08055) - 1556888..1557670 (+) 783 WP_011681555.1 carbonic anhydrase family protein -
  IBC03_RS08040 (IBC03_08060) - 1557721..1558173 (+) 453 WP_014608655.1 GNAT family N-acetyltransferase -
  IBC03_RS08045 (IBC03_08065) - 1558524..1558829 (-) 306 WP_014621914.1 restriction endonuclease subunit S -
  IBC03_RS10590 (IBC03_08070) mobV 1558854..1559362 (-) 509 Protein_1545 MobV family relaxase -
  IBC03_RS08055 (IBC03_08075) fetB 1559807..1560562 (-) 756 WP_011681558.1 iron export ABC transporter permease subunit FetB -
  IBC03_RS08060 (IBC03_08080) - 1560559..1561209 (-) 651 WP_011681559.1 ATP-binding cassette domain-containing protein -
  IBC03_RS08065 (IBC03_08085) - 1561412..1562368 (-) 957 WP_002951776.1 serine hydrolase domain-containing protein -
  IBC03_RS08070 (IBC03_08090) - 1562368..1563123 (-) 756 WP_011681560.1 CppA family protein -
  IBC03_RS08075 (IBC03_08095) - 1563405..1563767 (+) 363 WP_014608659.1 CPBP family intramembrane glutamic endopeptidase -
  IBC03_RS08080 (IBC03_08100) gla 1563854..1564717 (-) 864 WP_002951781.1 aquaglyceroporin Gla -
  IBC03_RS08085 (IBC03_08105) - 1564838..1567105 (+) 2268 WP_011681561.1 Xaa-Pro dipeptidyl-peptidase -
  IBC03_RS08090 (IBC03_08110) - 1567185..1567565 (-) 381 WP_002951783.1 hypothetical protein -
  IBC03_RS08095 (IBC03_08115) - 1567690..1567953 (-) 264 WP_002945924.1 hypothetical protein -
  IBC03_RS08100 (IBC03_08120) - 1568275..1568571 (-) 297 WP_004197070.1 bacteriocin immunity protein -
  IBC03_RS10310 - 1568736..1568867 (-) 132 WP_232659903.1 LPXTG cell wall anchor domain-containing protein -
  IBC03_RS08110 (IBC03_08130) - 1568973..1569662 (-) 690 WP_011681563.1 thioredoxin family protein -
  IBC03_RS08115 (IBC03_08135) - 1569856..1571426 (+) 1571 WP_087009847.1 IS3-like element ISSth1b family transposase -
  IBC03_RS08120 (IBC03_08140) - 1571572..1571826 (-) 255 WP_014608660.1 Blp family class II bacteriocin -
  IBC03_RS10595 - 1572077..1572478 (-) 402 WP_024703992.1 hypothetical protein -
  IBC03_RS08125 (IBC03_08145) - 1573483..1573713 (-) 231 WP_014608662.1 bacteriocin class II family protein -
  IBC03_RS08130 (IBC03_08150) - 1574069..1574269 (-) 201 WP_011681569.1 hypothetical protein -
  IBC03_RS08135 (IBC03_08155) - 1574288..1574464 (-) 177 WP_011681570.1 Blp family class II bacteriocin -
  IBC03_RS08140 (IBC03_08160) - 1574715..1575452 (+) 738 WP_011681571.1 response regulator transcription factor -
  IBC03_RS10315 - 1575983..1576786 (+) 804 WP_223899638.1 ATP-binding protein -
  IBC03_RS08150 (IBC03_08170) - 1576804..1576965 (-) 162 WP_011681573.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  IBC03_RS08155 (IBC03_08175) - 1576980..1578347 (-) 1368 WP_138496440.1 bacteriocin secretion accessory protein -
  IBC03_RS08160 (IBC03_08180) - 1578363..1580515 (-) 2153 Protein_1568 peptide cleavage/export ABC transporter -
  IBC03_RS08170 (IBC03_08190) - 1581529..1583274 (-) 1746 WP_024703994.1 ABC transporter ATP-binding protein -
  IBC03_RS08175 (IBC03_08195) - 1583267..1585024 (-) 1758 WP_014608668.1 ABC transporter transmembrane domain-containing protein -
  IBC03_RS10320 - 1585212..1585418 (-) 207 WP_002948879.1 hypothetical protein -
  IBC03_RS08185 (IBC03_08205) - 1585623..1586150 (-) 528 WP_011226503.1 VanZ family protein -
  IBC03_RS08190 (IBC03_08210) rlmN 1586152..1587321 (-) 1170 WP_011226504.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  IBC03_RS08195 (IBC03_08215) - 1587325..1588047 (-) 723 WP_011226505.1 YutD family protein -
  IBC03_RS08200 (IBC03_08220) - 1588102..1589457 (-) 1356 WP_002948886.1 metallophosphatase -
  IBC03_RS08210 (IBC03_08225) - 1590305..1591648 (-) 1344 WP_014608670.1 DEAD/DEAH box helicase -
  IBC03_RS08215 (IBC03_08230) mraY 1591723..1592745 (-) 1023 WP_011227524.1 phospho-N-acetylmuramoyl-pentapeptide- transferase -
  IBC03_RS08220 (IBC03_08235) pbp2X 1592747..1595014 (-) 2268 WP_011226508.1 penicillin-binding protein PBP2X -
  IBC03_RS08225 (IBC03_08240) ftsL 1595018..1595338 (-) 321 WP_014608671.1 cell division protein FtsL -
  IBC03_RS08230 (IBC03_08245) rsmH 1595341..1596291 (-) 951 WP_002888254.1 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH -
  IBC03_RS08235 (IBC03_08250) - 1596458..1597189 (-) 732 WP_224103288.1 hypothetical protein -
  IBC03_RS08245 (IBC03_08260) - 1597518..1597781 (+) 264 WP_162877224.1 hypothetical protein -
  IBC03_RS08250 (IBC03_08265) - 1598087..1598443 (-) 357 WP_023909925.1 DUF805 domain-containing protein -
  IBC03_RS08255 (IBC03_08270) - 1598792..1598959 (-) 168 WP_153300736.1 hypothetical protein -
  IBC03_RS08260 (IBC03_08275) - 1599292..1600542 (-) 1251 WP_014608675.1 glutamate-5-semialdehyde dehydrogenase -
  IBC03_RS08265 (IBC03_08280) proB 1600544..1601347 (-) 804 WP_014608676.1 glutamate 5-kinase -
  IBC03_RS08270 (IBC03_08285) - 1601468..1603057 (-) 1590 WP_014608677.1 ABC transporter permease -

Sequence


Protein


Download         Length: 358 a.a.        Molecular weight: 39172.02 Da        Isoelectric Point: 9.3888

>NTDB_id=479836 IBC03_RS07980 WP_011681549.1 1545524..1546600(-) (sepM) [Streptococcus thermophilus strain 13496]
MANKTKSKALLEKMWRIKWWLLSIFTVLFLLFALFFPLNNYYVELPGGAFDTKEVLTVNKKADDSKGSYNFVAVAQTKAT
LALMLYAQFNDFAKLQTAEEATGNYSDEDFMRINQFYMETSQNQAVYQGLTLAGKEVSLEYMGVYVLQVADDSSFKGVLN
IADTVTAVNGNTFDNSTDMIKYVQGLKLGSKVKVTYMRDGKEKTATGKIIKIANGKNGIGIGLTDHTEIKSPENVKFKLD
GVGGPSAGLMFTLAIYDQVSGQDLKAGRKIAGTGTIEKDGAVGDIGGAYLKVKSAADSGADIFFVPNNLVTKEMKKADPD
AKTNYQEAKEAAEKLGTKMKIVPVKTAQEAIDYLKKTK

Nucleotide


Download         Length: 1077 bp        

>NTDB_id=479836 IBC03_RS07980 WP_011681549.1 1545524..1546600(-) (sepM) [Streptococcus thermophilus strain 13496]
GTGGCAAACAAGACAAAATCTAAAGCGCTATTAGAGAAAATGTGGCGTATTAAGTGGTGGTTATTAAGTATTTTTACGGT
ACTTTTCCTCCTTTTTGCCCTCTTTTTCCCGCTCAATAATTACTATGTGGAGCTTCCGGGTGGTGCTTTTGATACCAAGG
AAGTCTTGACAGTGAATAAGAAAGCTGATGATTCTAAGGGCTCCTATAATTTTGTGGCGGTGGCTCAAACCAAGGCGACT
TTGGCCTTGATGCTCTATGCTCAGTTTAATGATTTTGCAAAGCTTCAAACGGCTGAAGAGGCAACTGGAAATTACTCTGA
TGAAGATTTCATGCGCATCAACCAATTTTACATGGAGACTTCTCAAAACCAAGCGGTTTATCAGGGCTTGACTCTGGCTG
GTAAGGAGGTTAGTTTGGAGTATATGGGTGTCTATGTGCTTCAGGTTGCTGATGATTCTAGCTTCAAGGGTGTCCTCAAT
ATTGCTGATACGGTGACGGCTGTTAATGGTAATACCTTTGATAATTCTACTGACATGATTAAATACGTTCAAGGACTTAA
GCTGGGTTCAAAGGTCAAGGTCACTTATATGAGAGATGGCAAAGAAAAGACTGCTACTGGTAAGATTATTAAGATTGCCA
ATGGCAAAAATGGTATTGGTATCGGCCTAACGGACCATACTGAGATCAAGAGTCCTGAGAATGTTAAGTTTAAACTGGAT
GGTGTCGGTGGGCCAAGTGCTGGTCTTATGTTTACCTTGGCTATTTACGATCAGGTGTCTGGTCAAGACCTCAAGGCTGG
CCGCAAGATTGCTGGTACAGGAACTATTGAAAAAGATGGGGCTGTCGGTGATATCGGTGGGGCCTATCTCAAGGTGAAAT
CTGCGGCTGATAGTGGCGCAGACATTTTCTTCGTGCCAAATAATCTAGTAACTAAGGAAATGAAAAAGGCTGATCCGGAT
GCCAAGACTAATTATCAAGAGGCCAAGGAAGCTGCCGAGAAACTGGGGACCAAGATGAAAATCGTCCCTGTTAAAACAGC
TCAAGAAGCCATTGATTATTTGAAAAAGACTAAATGA

Domains


Predicted by InterproScan.

(137-206)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sepM Streptococcus mutans UA159

62.757

95.251

0.598