Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   J4A01_RS02015 Genome accession   NZ_CP071932
Coordinates   398011..398130 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   A7Z1C5
Organism   Bacillus amyloliquefaciens strain CAS02     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 393011..403130
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J4A01_RS02000 (J4A01_01985) - 394623..395306 (+) 684 WP_032872879.1 response regulator transcription factor -
  J4A01_RS02005 (J4A01_01990) - 395293..396726 (+) 1434 WP_161503657.1 sensor histidine kinase -
  J4A01_RS02010 (J4A01_01995) rapC 396879..398027 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  J4A01_RS02015 (J4A01_02000) phrC 398011..398130 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  J4A01_RS02020 (J4A01_02005) - 398281..398391 (-) 111 WP_369878517.1 YjcZ family sporulation protein -
  J4A01_RS02025 (J4A01_02010) - 398471..399835 (-) 1365 WP_007609394.1 aspartate kinase -
  J4A01_RS02030 (J4A01_02015) ceuB 400249..401202 (+) 954 WP_032872883.1 ABC transporter permease Machinery gene
  J4A01_RS02035 (J4A01_02020) - 401192..402139 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  J4A01_RS02040 (J4A01_02025) - 402133..402891 (+) 759 WP_007609404.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=479546 J4A01_RS02015 WP_003156334.1 398011..398130(+) (phrC) [Bacillus amyloliquefaciens strain CAS02]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=479546 J4A01_RS02015 WP_003156334.1 398011..398130(+) (phrC) [Bacillus amyloliquefaciens strain CAS02]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGAGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z1C5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718