Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   H9S87_RS14370 Genome accession   NZ_CP060799
Coordinates   2807743..2807883 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain ONU 554     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2802743..2812883
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H9S87_RS14345 (H9S87_14345) - 2803009..2803398 (-) 390 WP_034659822.1 hotdog fold thioesterase -
  H9S87_RS14350 (H9S87_14350) comA 2803422..2804063 (-) 642 WP_058013793.1 response regulator transcription factor Regulator
  H9S87_RS14355 (H9S87_14355) comP 2804144..2806456 (-) 2313 WP_095285837.1 ATP-binding protein Regulator
  H9S87_RS14360 (H9S87_14360) comX 2806513..2806680 (-) 168 WP_081311380.1 competence pheromone ComX -
  H9S87_RS14365 (H9S87_14365) - 2806677..2807591 (-) 915 WP_034659828.1 polyprenyl synthetase family protein -
  H9S87_RS14370 (H9S87_14370) degQ 2807743..2807883 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  H9S87_RS14375 (H9S87_14375) - 2808389..2808742 (+) 354 WP_034659829.1 hypothetical protein -
  H9S87_RS14380 (H9S87_14380) - 2808776..2810002 (-) 1227 WP_034659830.1 EAL and HDOD domain-containing protein -
  H9S87_RS14385 (H9S87_14385) - 2810141..2811610 (-) 1470 WP_034659831.1 nicotinate phosphoribosyltransferase -
  H9S87_RS14390 (H9S87_14390) - 2811628..2812179 (-) 552 WP_034659832.1 cysteine hydrolase family protein -
  H9S87_RS14395 (H9S87_14395) - 2812240..2812647 (-) 408 WP_034659833.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=478445 H9S87_RS14370 WP_003213123.1 2807743..2807883(-) (degQ) [Bacillus pumilus strain ONU 554]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=478445 H9S87_RS14370 WP_003213123.1 2807743..2807883(-) (degQ) [Bacillus pumilus strain ONU 554]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696