Detailed information
Overview
| Name | cipB | Type | Regulator |
| Locus tag | SPN994039_RS02610 | Genome accession | NC_021005 |
| Coordinates | 485617..485766 (+) | Length | 49 a.a. |
| NCBI ID | WP_001808912.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae SPN994039 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 480617..490766
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPN994039_RS02585 (SPN994039_04800) | blpC | 480928..481083 (-) | 156 | WP_000358813.1 | quorum-sensing system pheromone BlpC | - |
| SPN994039_RS02590 (SPN994039_04810) | - | 481140..482501 (-) | 1362 | WP_001069092.1 | bacteriocin secretion accessory protein | - |
| SPN994039_RS13305 | comA/nlmT | 482512..483000 (-) | 489 | WP_307774349.1 | ATP-binding cassette domain-containing protein | Regulator |
| SPN994039_RS13310 | comA/nlmT | 482984..483424 (-) | 441 | WP_001808911.1 | ATP-binding cassette domain-containing protein | Regulator |
| SPN994039_RS13315 | comA/nlmT | 483414..484139 (-) | 726 | WP_167750760.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| SPN994039_RS13320 (SPN994039_04830) | comA/nlmT | 484084..484671 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| SPN994039_RS02605 (SPN994039_04840) | blpI | 484953..485150 (+) | 198 | WP_001093258.1 | bacteriocin-like peptide BlpI | - |
| SPN994039_RS02610 | cipB | 485617..485766 (+) | 150 | WP_001808912.1 | bacteriocin-like peptide BlpO | Regulator |
| SPN994039_RS02615 (SPN994039_04880) | - | 485870..485989 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| SPN994039_RS02625 (SPN994039_04910) | - | 486775..487158 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| SPN994039_RS02630 (SPN994039_04920) | - | 487210..487899 (+) | 690 | WP_000760526.1 | CPBP family intramembrane glutamic endopeptidase | - |
| SPN994039_RS02635 (SPN994039_04930) | blpZ | 487941..488189 (+) | 249 | WP_000276499.1 | immunity protein BlpZ | - |
| SPN994039_RS02640 (SPN994039_04940) | - | 488219..488830 (+) | 612 | WP_000394047.1 | type II CAAX endopeptidase family protein | - |
| SPN994039_RS02645 (SPN994039_04950) | - | 488991..489785 (+) | 795 | WP_000363002.1 | phosphotransferase family protein | - |
| SPN994039_RS02650 (SPN994039_04960) | trmB | 489782..490417 (+) | 636 | WP_001266080.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5150.86 Da Isoelectric Point: 3.7098
>NTDB_id=47791 SPN994039_RS02610 WP_001808912.1 485617..485766(+) (cipB) [Streptococcus pneumoniae SPN994039]
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=47791 SPN994039_RS02610 WP_001808912.1 485617..485766(+) (cipB) [Streptococcus pneumoniae SPN994039]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |