Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   JWY36_RS12655 Genome accession   NZ_CP071276
Coordinates   2356977..2357150 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain JNFE0126     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2351977..2362150
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JWY36_RS12640 (JWY36_12530) gcvT 2352776..2353864 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  JWY36_RS12645 (JWY36_12535) hepAA 2354306..2355979 (+) 1674 WP_014480248.1 DEAD/DEAH box helicase -
  JWY36_RS12650 (JWY36_12540) yqhG 2356000..2356794 (+) 795 WP_014480249.1 YqhG family protein -
  JWY36_RS12655 (JWY36_12545) sinI 2356977..2357150 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  JWY36_RS12660 (JWY36_12550) sinR 2357184..2357519 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  JWY36_RS12665 (JWY36_12555) tasA 2357612..2358397 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  JWY36_RS12670 (JWY36_12560) sipW 2358461..2359033 (-) 573 WP_003230181.1 signal peptidase I SipW -
  JWY36_RS12675 (JWY36_12565) tapA 2359017..2359778 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  JWY36_RS12680 (JWY36_12570) yqzG 2360050..2360376 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  JWY36_RS12685 (JWY36_12575) spoIITA 2360418..2360597 (-) 180 WP_014480252.1 YqzE family protein -
  JWY36_RS12690 (JWY36_12580) comGG 2360668..2361042 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  JWY36_RS12695 (JWY36_12585) comGF 2361043..2361426 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  JWY36_RS12700 (JWY36_12590) comGE 2361452..2361799 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=476573 JWY36_RS12655 WP_003230187.1 2356977..2357150(+) (sinI) [Bacillus subtilis strain JNFE0126]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=476573 JWY36_RS12655 WP_003230187.1 2356977..2357150(+) (sinI) [Bacillus subtilis strain JNFE0126]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterProScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1