Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   JS608_RS17690 Genome accession   NZ_CP071042
Coordinates   3559264..3559404 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens isolate ELA1901024     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3554264..3564404
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JS608_RS17665 (JS608_03535) - 3554591..3554974 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  JS608_RS17670 (JS608_03536) comA 3554996..3555640 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  JS608_RS17675 (JS608_03537) comP 3555721..3558027 (-) 2307 WP_044052948.1 sensor histidine kinase Regulator
  JS608_RS17680 (JS608_03538) comX 3558046..3558222 (-) 177 WP_044052947.1 competence pheromone ComX -
  JS608_RS17685 (JS608_03539) comQ 3558237..3559112 (-) 876 WP_026092320.1 polyprenyl synthetase family protein Regulator
  JS608_RS17690 (JS608_03540) degQ 3559264..3559404 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  JS608_RS17695 (JS608_03542) - 3559870..3560211 (+) 342 WP_014305721.1 hypothetical protein -
  JS608_RS17700 (JS608_03543) - 3560218..3561438 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  JS608_RS17705 (JS608_03544) - 3561568..3563034 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  JS608_RS17710 (JS608_03545) - 3563052..3563603 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  JS608_RS17715 (JS608_03546) - 3563700..3564098 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=475734 JS608_RS17690 WP_003152043.1 3559264..3559404(-) (degQ) [Bacillus amyloliquefaciens isolate ELA1901024]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=475734 JS608_RS17690 WP_003152043.1 3559264..3559404(-) (degQ) [Bacillus amyloliquefaciens isolate ELA1901024]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891