Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | JS608_RS17690 | Genome accession | NZ_CP071042 |
| Coordinates | 3559264..3559404 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus amyloliquefaciens isolate ELA1901024 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3554264..3564404
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JS608_RS17665 (JS608_03535) | - | 3554591..3554974 (-) | 384 | WP_003152054.1 | hotdog fold thioesterase | - |
| JS608_RS17670 (JS608_03536) | comA | 3554996..3555640 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| JS608_RS17675 (JS608_03537) | comP | 3555721..3558027 (-) | 2307 | WP_044052948.1 | sensor histidine kinase | Regulator |
| JS608_RS17680 (JS608_03538) | comX | 3558046..3558222 (-) | 177 | WP_044052947.1 | competence pheromone ComX | - |
| JS608_RS17685 (JS608_03539) | comQ | 3558237..3559112 (-) | 876 | WP_026092320.1 | polyprenyl synthetase family protein | Regulator |
| JS608_RS17690 (JS608_03540) | degQ | 3559264..3559404 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| JS608_RS17695 (JS608_03542) | - | 3559870..3560211 (+) | 342 | WP_014305721.1 | hypothetical protein | - |
| JS608_RS17700 (JS608_03543) | - | 3560218..3561438 (-) | 1221 | WP_003152038.1 | EAL and HDOD domain-containing protein | - |
| JS608_RS17705 (JS608_03544) | - | 3561568..3563034 (-) | 1467 | WP_014305722.1 | nicotinate phosphoribosyltransferase | - |
| JS608_RS17710 (JS608_03545) | - | 3563052..3563603 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| JS608_RS17715 (JS608_03546) | - | 3563700..3564098 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=475734 JS608_RS17690 WP_003152043.1 3559264..3559404(-) (degQ) [Bacillus amyloliquefaciens isolate ELA1901024]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=475734 JS608_RS17690 WP_003152043.1 3559264..3559404(-) (degQ) [Bacillus amyloliquefaciens isolate ELA1901024]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |