Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   JS608_RS03995 Genome accession   NZ_CP071042
Coordinates   815948..816067 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   A7Z1C5
Organism   Bacillus amyloliquefaciens isolate ELA1901024     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 810948..821067
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JS608_RS03980 (JS608_00793) - 812560..813243 (+) 684 WP_024084885.1 response regulator transcription factor -
  JS608_RS03985 (JS608_00794) - 813230..814663 (+) 1434 WP_161625271.1 HAMP domain-containing sensor histidine kinase -
  JS608_RS03990 (JS608_00795) rapC 814816..815964 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  JS608_RS03995 (JS608_00796) phrC 815948..816067 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  JS608_RS04000 - 816217..816327 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  JS608_RS04005 (JS608_00797) - 816407..817771 (-) 1365 WP_003156333.1 aspartate kinase -
  JS608_RS04010 (JS608_00798) ceuB 818186..819139 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  JS608_RS04015 (JS608_00799) - 819129..820076 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  JS608_RS04020 (JS608_00800) - 820070..820828 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=475637 JS608_RS03995 WP_003156334.1 815948..816067(+) (phrC) [Bacillus amyloliquefaciens isolate ELA1901024]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=475637 JS608_RS03995 WP_003156334.1 815948..816067(+) (phrC) [Bacillus amyloliquefaciens isolate ELA1901024]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z1C5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718