Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   H7F26_RS19405 Genome accession   NZ_CP060192
Coordinates   3763369..3763545 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus sp. PAMC28748     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 3758369..3768545
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H7F26_RS19390 (H7F26_19390) gcvT 3759011..3760105 (-) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -
  H7F26_RS19395 (H7F26_19395) - 3760698..3762377 (+) 1680 WP_003183439.1 DEAD/DEAH box helicase -
  H7F26_RS19400 (H7F26_19400) - 3762384..3763178 (+) 795 WP_003183441.1 YqhG family protein -
  H7F26_RS19405 (H7F26_19405) sinI 3763369..3763545 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  H7F26_RS19410 (H7F26_19410) sinR 3763579..3763914 (+) 336 WP_025804940.1 transcriptional regulator SinR Regulator
  H7F26_RS19415 (H7F26_19415) tasA 3764019..3764813 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  H7F26_RS19420 (H7F26_19420) sipW 3764887..3765471 (-) 585 WP_003183449.1 signal peptidase I SipW -
  H7F26_RS19425 (H7F26_19425) tapA 3765468..3766196 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  H7F26_RS19430 (H7F26_19430) - 3766473..3766793 (+) 321 WP_003183454.1 YqzG/YhdC family protein -
  H7F26_RS19435 (H7F26_19435) - 3766817..3766999 (-) 183 WP_003183456.1 YqzE family protein -
  H7F26_RS19440 (H7F26_19440) comGG 3767088..3767453 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  H7F26_RS19445 (H7F26_19445) comGF 3767466..3767954 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  H7F26_RS19450 (H7F26_19450) comGE 3767863..3768210 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=474453 H7F26_RS19405 WP_003183444.1 3763369..3763545(+) (sinI) [Bacillus sp. PAMC28748]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=474453 H7F26_RS19405 WP_003183444.1 3763369..3763545(+) (sinI) [Bacillus sp. PAMC28748]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517