Detailed information    

insolico Bioinformatically predicted

Overview


Name   comZ   Type   Regulator
Locus tag   I653_RS05900 Genome accession   NC_020832
Coordinates   1171663..1171854 (+) Length   63 a.a.
NCBI ID   WP_003224559.1    Uniprot ID   G4NWD2
Organism   Bacillus subtilis subsp. subtilis str. BAB-1     
Function   repression of comG operon (predicted from homology)   
Competence regulation

Genomic Context


Location: 1166663..1176854
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I653_RS05870 (I653_05710) argF 1167526..1168485 (+) 960 WP_015383338.1 ornithine carbamoyltransferase -
  I653_RS05875 (I653_05715) yjzC 1168571..1168750 (+) 180 WP_003245356.1 YjzC family protein -
  I653_RS05880 (I653_05720) yjzD 1168796..1168981 (-) 186 WP_003245236.1 DUF2929 domain-containing protein -
  I653_RS05885 (I653_05725) - 1169232..1169966 (+) 735 WP_015483082.1 hypothetical protein -
  I653_RS05890 (I653_05730) - 1170048..1170605 (+) 558 WP_015383340.1 hypothetical protein -
  I653_RS05895 (I653_05735) med 1170695..1171648 (+) 954 WP_014476425.1 transcriptional regulator Med Regulator
  I653_RS05900 (I653_05740) comZ 1171663..1171854 (+) 192 WP_003224559.1 ComG operon transcriptional repressor ComZ Regulator
  I653_RS05905 (I653_05745) yjzB 1171884..1172120 (-) 237 WP_015383342.1 spore coat protein YjzB -
  I653_RS05910 (I653_05750) fabH 1172285..1173223 (+) 939 WP_015483083.1 beta-ketoacyl-ACP synthase III -
  I653_RS05915 (I653_05755) fabF 1173246..1174487 (+) 1242 WP_003244890.1 beta-ketoacyl-ACP synthase II -
  I653_RS05920 (I653_05760) yjaZ 1174563..1175348 (+) 786 WP_015383343.1 DUF2268 domain-containing protein -
  I653_RS05925 (I653_05765) appD 1175541..1176527 (+) 987 WP_015383344.1 oligopeptide ABC transporter ATP-binding protein AppD -

Sequence


Protein


Download         Length: 63 a.a.        Molecular weight: 7214.27 Da        Isoelectric Point: 4.2564

>NTDB_id=47443 I653_RS05900 WP_003224559.1 1171663..1171854(+) (comZ) [Bacillus subtilis subsp. subtilis str. BAB-1]
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE

Nucleotide


Download         Length: 192 bp        

>NTDB_id=47443 I653_RS05900 WP_003224559.1 1171663..1171854(+) (comZ) [Bacillus subtilis subsp. subtilis str. BAB-1]
ATGCAGCACGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATC
AGGCATTGAGCTCTCAATGGAGGCCATACAGCCGTTTATGAATCTGTTTACAACGGTAATGGCGGAAGCTTATGAGCTTG
GCAAGTCTGACGCTAAATCTGAAACAGAATAA

Domains


Predicted by InterProScan.

(4-58)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4NWD2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment