Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   H6X75_RS02620 Genome accession   NZ_CP060156
Coordinates   505339..505488 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain PZ900700608     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 500339..510488
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H6X75_RS02600 (H6X75_02575) comA/nlmT 501405..503081 (-) 1677 WP_196300924.1 peptide cleavage/export ABC transporter Regulator
  H6X75_RS11325 (H6X75_02580) comA/nlmT 502975..503562 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  H6X75_RS02605 (H6X75_02585) blpI 503844..504041 (+) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  H6X75_RS02610 (H6X75_02590) blpJ 504509..504778 (+) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  H6X75_RS02615 (H6X75_02595) blpK 504847..505095 (+) 249 WP_000379965.1 bacteriocin-like peptide BlpK -
  H6X75_RS02620 (H6X75_02600) cipB 505339..505488 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  H6X75_RS02625 (H6X75_02605) - 505592..505711 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  H6X75_RS02630 (H6X75_02610) - 506231..506550 (+) 320 Protein_520 immunity protein -
  H6X75_RS02635 (H6X75_02615) - 507179..507562 (+) 384 WP_000877381.1 hypothetical protein -
  H6X75_RS02640 (H6X75_02620) - 507614..508303 (+) 690 WP_000760532.1 CPBP family intramembrane glutamic endopeptidase -
  H6X75_RS02645 (H6X75_02625) blpZ 508345..508578 (+) 234 WP_000276498.1 immunity protein BlpZ -
  H6X75_RS02650 (H6X75_02630) - 508729..509340 (+) 612 WP_000394044.1 type II CAAX endopeptidase family protein -
  H6X75_RS02655 (H6X75_02635) - 509501..510295 (+) 795 WP_000363002.1 phosphotransferase family protein -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=474140 H6X75_RS02620 WP_001809846.1 505339..505488(+) (cipB) [Streptococcus pneumoniae strain PZ900700608]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=474140 H6X75_RS02620 WP_001809846.1 505339..505488(+) (cipB) [Streptococcus pneumoniae strain PZ900700608]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531