Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   H4O16_RS20365 Genome accession   NZ_CP059975
Coordinates   3953798..3954076 (-) Length   92 a.a.
NCBI ID   WP_042991630.1    Uniprot ID   A0A9X6KPT6
Organism   Bacillus thuringiensis strain G03     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Genomic Context

Location: 3948798..3959076
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H4O16_RS20315 (H4O16_20140) - 3949218..3949688 (-) 471 WP_021727598.1 ArpU family phage packaging/lysis transcriptional regulator -
  H4O16_RS20320 (H4O16_20145) - 3949709..3949879 (-) 171 WP_021727599.1 hypothetical protein -
  H4O16_RS20325 (H4O16_20150) - 3950139..3950381 (-) 243 WP_021727600.1 hypothetical protein -
  H4O16_RS20330 (H4O16_20155) - 3950920..3951102 (-) 183 WP_021727601.1 hypothetical protein -
  H4O16_RS20335 (H4O16_20160) - 3951141..3951338 (-) 198 WP_021727602.1 hypothetical protein -
  H4O16_RS20340 (H4O16_20165) - 3951930..3952337 (-) 408 WP_016090376.1 hypothetical protein -
  H4O16_RS20345 (H4O16_20170) - 3952508..3952963 (-) 456 WP_021728086.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  H4O16_RS20350 (H4O16_20175) - 3952983..3953234 (-) 252 WP_042991632.1 hypothetical protein -
  H4O16_RS20355 (H4O16_20180) - 3953260..3953427 (-) 168 WP_000717826.1 DUF3954 domain-containing protein -
  H4O16_RS20360 (H4O16_20185) - 3953446..3953805 (-) 360 WP_023522897.1 hypothetical protein -
  H4O16_RS20365 (H4O16_20190) abrB 3953798..3954076 (-) 279 WP_042991630.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  H4O16_RS20370 (H4O16_20195) - 3954093..3954287 (-) 195 WP_021727623.1 hypothetical protein -
  H4O16_RS20375 (H4O16_20200) - 3954300..3955214 (-) 915 WP_021727897.1 AAA family ATPase -
  H4O16_RS20380 (H4O16_20205) - 3955229..3956080 (-) 852 WP_021727896.1 phage replisome organizer N-terminal domain-containing protein -
  H4O16_RS20385 (H4O16_20210) - 3956086..3956262 (-) 177 WP_021727895.1 hypothetical protein -
  H4O16_RS20390 (H4O16_20215) - 3956292..3956456 (-) 165 WP_021727894.1 hypothetical protein -
  H4O16_RS20395 (H4O16_20220) - 3956513..3956713 (-) 201 WP_000284333.1 helix-turn-helix domain-containing protein -
  H4O16_RS20400 (H4O16_20225) - 3956822..3957016 (-) 195 WP_000935436.1 helix-turn-helix domain-containing protein -
  H4O16_RS20405 (H4O16_20230) - 3957184..3957540 (+) 357 WP_016125848.1 helix-turn-helix domain-containing protein -
  H4O16_RS20410 (H4O16_20235) - 3957537..3957719 (-) 183 WP_021727893.1 hypothetical protein -
  H4O16_RS20415 (H4O16_20240) - 3957862..3957996 (-) 135 WP_023901278.1 hypothetical protein -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10108.67 Da        Isoelectric Point: 7.1683

>NTDB_id=473036 H4O16_RS20365 WP_042991630.1 3953798..3954076(-) (abrB) [Bacillus thuringiensis strain G03]
MKNTGVTRKVDELGRVVIPVELRRTLGIAEGTALDFHVDGENVVLRKQEKSCFVTGKVSDSNIELLGGRMFLSKEGALEL
LNSLEKSVKEHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=473036 H4O16_RS20365 WP_042991630.1 3953798..3954076(-) (abrB) [Bacillus thuringiensis strain G03]
ATGAAAAATACAGGTGTTACAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTGGG
TATTGCTGAAGGGACAGCATTAGACTTTCATGTTGATGGGGAAAATGTCGTTTTAAGAAAACAAGAAAAGTCATGCTTTG
TAACTGGTAAAGTATCTGATTCCAACATCGAATTGTTAGGTGGCCGAATGTTTTTGAGTAAGGAAGGGGCACTTGAGTTA
CTCAACTCTCTTGAAAAGAGTGTGAAGGAACATGCCTAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(52-86)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-49)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

54.945

98.913

0.543