Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   H2R00_RS02265 Genome accession   NZ_CP059494
Coordinates   432176..432352 (-) Length   58 a.a.
NCBI ID   WP_154997624.1    Uniprot ID   -
Organism   Bacillus haynesii strain P19     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 427176..437352
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H2R00_RS02220 comGE 427507..427854 (+) 348 WP_182070386.1 competence type IV pilus minor pilin ComGE -
  H2R00_RS02225 comGF 427880..428251 (+) 372 WP_261763563.1 competence type IV pilus minor pilin ComGF -
  H2R00_RS02230 comGG 428263..428628 (+) 366 WP_154997614.1 competence type IV pilus minor pilin ComGG -
  H2R00_RS02235 - 428717..428899 (+) 183 WP_020452171.1 YqzE family protein -
  H2R00_RS02240 - 428929..429249 (-) 321 WP_076793488.1 YqzG/YhdC family protein -
  H2R00_RS02245 tapA 429526..430254 (+) 729 WP_182070387.1 amyloid fiber anchoring/assembly protein TapA -
  H2R00_RS02250 - 430251..430835 (+) 585 WP_154997620.1 signal peptidase I -
  H2R00_RS02255 - 430908..431702 (+) 795 WP_154997622.1 TasA family protein -
  H2R00_RS02260 sinR 431807..432142 (-) 336 WP_006637528.1 helix-turn-helix domain-containing protein Regulator
  H2R00_RS02265 sinI 432176..432352 (-) 177 WP_154997624.1 anti-repressor SinI family protein Regulator
  H2R00_RS02270 - 432548..433336 (-) 789 WP_182070388.1 YqhG family protein -
  H2R00_RS02275 - 433343..435022 (-) 1680 WP_154997698.1 SNF2-related protein -
  H2R00_RS02280 gcvT 435615..436709 (+) 1095 WP_182070389.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6706.55 Da        Isoelectric Point: 5.0909

>NTDB_id=470039 H2R00_RS02265 WP_154997624.1 432176..432352(-) (sinI) [Bacillus haynesii strain P19]
MNKDKNEKEELDEEWTELIKHALEQGISPEEIRIFLNLGKKSAKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=470039 H2R00_RS02265 WP_154997624.1 432176..432352(-) (sinI) [Bacillus haynesii strain P19]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACATGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTGCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

55.172

100

0.552