Detailed information    

insolico Bioinformatically predicted

Overview


Name   abrB   Type   Regulator
Locus tag   H0242_RS12780 Genome accession   NZ_CP059148
Coordinates   2525766..2526044 (+) Length   92 a.a.
NCBI ID   WP_086406146.1    Uniprot ID   -
Organism   Bacillus thuringiensis serovar sumiyoshiensis strain 4AO1     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Genomic Context


Location: 2520766..2531044
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H0242_RS12740 (H0242_12590) - 2521149..2522342 (+) 1194 WP_086406143.1 AimR family lysis-lysogeny pheromone receptor -
  H0242_RS12745 - 2522576..2522710 (+) 135 WP_254905513.1 hypothetical protein -
  H0242_RS12750 (H0242_12595) - 2522747..2523100 (-) 354 WP_000481768.1 helix-turn-helix domain-containing protein -
  H0242_RS12755 (H0242_12600) - 2523301..2523486 (+) 186 WP_000854264.1 helix-turn-helix domain-containing protein -
  H0242_RS12760 (H0242_12605) - 2523644..2523919 (+) 276 WP_086406298.1 helix-turn-helix domain-containing protein -
  H0242_RS12765 (H0242_12610) - 2523976..2524131 (+) 156 WP_086406144.1 hypothetical protein -
  H0242_RS12770 (H0242_12615) - 2524199..2525266 (+) 1068 WP_086406145.1 DnaD domain-containing protein -
  H0242_RS12775 (H0242_12620) - 2525270..2525752 (+) 483 WP_061685158.1 YpiB family protein -
  H0242_RS12780 (H0242_12625) abrB 2525766..2526044 (+) 279 WP_086406146.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  H0242_RS12785 (H0242_12630) - 2526037..2526396 (+) 360 WP_033698079.1 hypothetical protein -
  H0242_RS12790 (H0242_12635) - 2526416..2526580 (+) 165 WP_002066822.1 DUF3954 domain-containing protein -
  H0242_RS12795 (H0242_12640) - 2526606..2527079 (+) 474 WP_086406147.1 sugar ABC transporter substrate-binding protein -
  H0242_RS12800 (H0242_12645) - 2527100..2527615 (+) 516 WP_086406148.1 dUTP diphosphatase -
  H0242_RS12805 (H0242_12650) - 2527619..2528095 (+) 477 WP_086406149.1 hypothetical protein -
  H0242_RS12810 (H0242_12655) - 2528639..2528947 (+) 309 WP_086406150.1 hypothetical protein -
  H0242_RS12815 (H0242_12660) - 2528995..2529189 (-) 195 WP_086406151.1 hypothetical protein -
  H0242_RS12820 (H0242_12665) - 2529723..2529893 (+) 171 WP_412472298.1 hypothetical protein -
  H0242_RS12825 (H0242_12670) - 2529932..2530129 (+) 198 WP_086406152.1 hypothetical protein -
  H0242_RS12830 (H0242_12675) - 2530165..2530425 (+) 261 WP_086406153.1 hypothetical protein -

Sequence


Protein


Download         Length: 92 a.a.        Molecular weight: 9840.43 Da        Isoelectric Point: 5.8618

>NTDB_id=467370 H0242_RS12780 WP_086406146.1 2525766..2526044(+) (abrB) [Bacillus thuringiensis serovar sumiyoshiensis strain 4AO1]
MKNTGIVRKVDELGRVVIPVELRRTLGIAEGAAIGFHVEGGNIVLRKEEKSCFVTGESSESNIELLGGRMVLSKEGASEL
LDLLQKCGMANA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=467370 H0242_RS12780 WP_086406146.1 2525766..2526044(+) (abrB) [Bacillus thuringiensis serovar sumiyoshiensis strain 4AO1]
ATGAAAAACACAGGTATTGTAAGAAAAGTCGACGAGCTAGGGCGCGTAGTAATTCCAGTAGAGTTGCGTAGAACTTTAGG
GATAGCTGAAGGTGCAGCAATAGGTTTTCATGTCGAAGGGGGAAATATCGTTTTAAGAAAAGAGGAAAAATCATGCTTTG
TAACGGGGGAATCGTCTGAATCCAACATCGAATTGTTAGGCGGCCGAATGGTTTTGAGTAAGGAAGGAGCAAGTGAATTG
TTGGACCTTCTTCAAAAGTGTGGGATGGCAAATGCCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

58.621

94.565

0.554