Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   HZT12_RS14925 Genome accession   NZ_CP058796
Coordinates   2992043..2992672 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Shigella flexneri strain STLIN_8     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2982871..3020395 2992043..2992672 within 0


Gene organization within MGE regions


Location: 2982871..3020395
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HZT12_RS14875 (HZT12_14760) tusE 2983142..2983471 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  HZT12_RS14880 (HZT12_14765) yccX 2983468..2983746 (-) 279 WP_000048252.1 acylphosphatase -
  HZT12_RS14885 (HZT12_14770) rlmI 2983841..2985031 (+) 1191 WP_000116297.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  HZT12_RS14890 (HZT12_14775) hspQ 2985089..2985406 (+) 318 WP_001295356.1 heat shock protein HspQ -
  HZT12_RS14895 (HZT12_14780) - 2985451..2985864 (-) 414 WP_000665217.1 CoA-binding protein -
  HZT12_RS14900 (HZT12_14785) - 2986037..2986699 (+) 663 WP_000847785.1 DUF2057 family protein -
  HZT12_RS14905 (HZT12_14790) mgsA 2986795..2987253 (+) 459 WP_000424181.1 methylglyoxal synthase -
  HZT12_RS14910 (HZT12_14795) helD 2987285..2989339 (-) 2055 WP_240765526.1 DNA helicase IV -
  HZT12_RS14915 (HZT12_14800) - 2989462..2989908 (+) 447 WP_001261235.1 YccF domain-containing protein -
  HZT12_RS14920 (HZT12_14805) yccS 2989918..2992080 (+) 2163 WP_000875061.1 YccS family putative transporter -
  HZT12_RS14925 (HZT12_14810) sxy/tfoX 2992043..2992672 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  HZT12_RS14930 (HZT12_14815) sulA 2992891..2993400 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  HZT12_RS14935 (HZT12_14820) ompA 2993757..2994797 (+) 1041 WP_000750416.1 porin OmpA -
  HZT12_RS14940 (HZT12_14825) matP 2994873..2995325 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  HZT12_RS14945 (HZT12_14830) - 2995511..2997271 (+) 1761 WP_000156518.1 Lon protease family protein -
  HZT12_RS14950 (HZT12_14835) fabA 2997340..2997858 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  HZT12_RS14955 (HZT12_14840) rmf 2997928..2998095 (-) 168 WP_000828648.1 ribosome modulation factor -
  HZT12_RS14960 (HZT12_14845) pqiC 2998351..2998914 (-) 564 WP_032173938.1 membrane integrity-associated transporter subunit PqiC -
  HZT12_RS14965 (HZT12_14850) pqiB 2998911..3000551 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  HZT12_RS14970 (HZT12_14855) pqiA 3000556..3001809 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  HZT12_RS14975 (HZT12_14860) - 3001939..3003846 (-) 1908 WP_000053099.1 ABC transporter ATP-binding protein -
  HZT12_RS14980 (HZT12_14865) rlmKL 3003858..3005966 (-) 2109 WP_001086539.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  HZT12_RS14985 (HZT12_14870) ycbX 3006210..3007319 (+) 1110 WP_000212426.1 6-N-hydroxylaminopurine resistance protein YcbX -
  HZT12_RS14990 (HZT12_14875) zapC 3007316..3007858 (-) 543 WP_001295353.1 cell division protein ZapC -
  HZT12_RS14995 (HZT12_14880) pyrD 3008032..3009042 (-) 1011 WP_001295352.1 quinone-dependent dihydroorotate dehydrogenase -
  HZT12_RS15000 (HZT12_14885) - 3009153..3009890 (-) 738 WP_001111465.1 fimbrial chaperone -
  HZT12_RS15005 (HZT12_14890) - 3009856..3010371 (-) 516 WP_000919497.1 fimbrial protein -
  HZT12_RS15010 (HZT12_14895) - 3010379..3010921 (-) 543 WP_000730614.1 fimbrial protein -
  HZT12_RS15015 (HZT12_14900) - 3010933..3012003 (-) 1071 WP_016242025.1 fimbrial protein -
  HZT12_RS15020 (HZT12_14905) - 3011994..3014594 (-) 2601 WP_016242024.1 fimbrial biogenesis usher protein -
  HZT12_RS15025 (HZT12_14910) - 3014619..3015320 (-) 702 WP_016242023.1 molecular chaperone -
  HZT12_RS15030 (HZT12_14915) - 3015403..3015666 (-) 264 Protein_2952 fimbrial protein -
  HZT12_RS15035 (HZT12_14920) - 3015729..3016880 (+) 1152 WP_001254932.1 IS30-like element IS30 family transposase -
  HZT12_RS15040 (HZT12_14925) - 3016887..3017165 (-) 279 Protein_2954 fimbrial protein -
  HZT12_RS15045 (HZT12_14930) ssuE 3017521..3018096 (+) 576 WP_001263933.1 NADPH-dependent FMN reductase -
  HZT12_RS15050 (HZT12_14935) ssuA 3018089..3019048 (+) 960 WP_001244342.1 aliphatic sulfonate ABC transporter substrate-binding protein SsuA -
  HZT12_RS15055 (HZT12_14940) ssuD 3019045..3020190 (+) 1146 WP_000056006.1 FMNH2-dependent alkanesulfonate monooxygenase -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=465475 HZT12_RS14925 WP_000839153.1 2992043..2992672(-) (sxy/tfoX) [Shigella flexneri strain STLIN_8]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=465475 HZT12_RS14925 WP_000839153.1 2992043..2992672(-) (sxy/tfoX) [Shigella flexneri strain STLIN_8]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1