Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   HWV68_RS17130 Genome accession   NZ_CP058242
Coordinates   3257098..3257238 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SP1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3252098..3262238
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HWV68_RS17105 (HWV68_17100) yuxO 3252411..3252791 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  HWV68_RS17110 (HWV68_17105) comA 3252810..3253454 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  HWV68_RS17115 (HWV68_17110) comP 3253535..3255844 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  HWV68_RS17120 (HWV68_17115) comX 3255859..3256026 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  HWV68_RS17125 (HWV68_17120) comQ 3256014..3256913 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  HWV68_RS17130 (HWV68_17125) degQ 3257098..3257238 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  HWV68_RS17135 (HWV68_17130) - 3257460..3257585 (+) 126 WP_003228793.1 hypothetical protein -
  HWV68_RS17140 (HWV68_17135) - 3257699..3258067 (+) 369 WP_003243784.1 hypothetical protein -
  HWV68_RS17145 (HWV68_17140) pdeH 3258043..3259272 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  HWV68_RS17150 (HWV68_17145) pncB 3259409..3260881 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  HWV68_RS17155 (HWV68_17150) pncA 3260897..3261448 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  HWV68_RS17160 (HWV68_17155) yueI 3261545..3261943 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=462966 HWV68_RS17130 WP_003220708.1 3257098..3257238(-) (degQ) [Bacillus subtilis strain SP1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=462966 HWV68_RS17130 WP_003220708.1 3257098..3257238(-) (degQ) [Bacillus subtilis strain SP1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1