Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   HWH77_RS02690 Genome accession   NZ_CP058216
Coordinates   581046..581219 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain LF01     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 576046..586219
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HWH77_RS02675 (HWH77_02680) gcvT 576864..577964 (-) 1101 WP_069473502.1 glycine cleavage system aminomethyltransferase GcvT -
  HWH77_RS02680 (HWH77_02685) - 578387..580057 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  HWH77_RS02685 (HWH77_02690) - 580075..580869 (+) 795 WP_069473503.1 YqhG family protein -
  HWH77_RS02690 (HWH77_02695) sinI 581046..581219 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  HWH77_RS02695 (HWH77_02700) sinR 581253..581588 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HWH77_RS02700 (HWH77_02705) tasA 581636..582421 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  HWH77_RS02705 (HWH77_02710) sipW 582485..583069 (-) 585 WP_003153100.1 signal peptidase I SipW -
  HWH77_RS02710 (HWH77_02715) tapA 583041..583712 (-) 672 WP_046341384.1 amyloid fiber anchoring/assembly protein TapA -
  HWH77_RS02715 (HWH77_02720) - 583971..584300 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  HWH77_RS02720 (HWH77_02725) - 584340..584519 (-) 180 WP_003153093.1 YqzE family protein -
  HWH77_RS02725 (HWH77_02730) comGG 584576..584953 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  HWH77_RS02730 (HWH77_02735) comGF 584954..585349 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  HWH77_RS02735 (HWH77_02740) comGE 585363..585677 (-) 315 WP_046341385.1 competence type IV pilus minor pilin ComGE -
  HWH77_RS02740 (HWH77_02745) comGD 585661..586098 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=462676 HWH77_RS02690 WP_003153105.1 581046..581219(+) (sinI) [Bacillus velezensis strain LF01]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=462676 HWH77_RS02690 WP_003153105.1 581046..581219(+) (sinI) [Bacillus velezensis strain LF01]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702