Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   LILO_RS10880 Genome accession   NC_020450
Coordinates   2251376..2251660 (-) Length   94 a.a.
NCBI ID   WP_015427162.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis IO-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2246376..2256660
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LILO_RS10850 (lilo_2093) - 2246816..2247193 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  LILO_RS10855 (lilo_2094) - 2247398..2248264 (+) 867 WP_042230639.1 RluA family pseudouridine synthase -
  LILO_RS10860 (lilo_2095) - 2248302..2249111 (-) 810 WP_015427158.1 metal ABC transporter permease -
  LILO_RS10865 (lilo_2096) - 2249104..2249841 (-) 738 WP_015427159.1 metal ABC transporter ATP-binding protein -
  LILO_RS10870 (lilo_2097) - 2250018..2250860 (-) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  LILO_RS10875 (lilo_2098) - 2250857..2251294 (-) 438 WP_015427161.1 zinc-dependent MarR family transcriptional regulator -
  LILO_RS10880 (lilo_2099) comGG 2251376..2251660 (-) 285 WP_015427162.1 competence type IV pilus minor pilin ComGG Machinery gene
  LILO_RS10885 (lilo_2100) comGF 2251699..2252145 (-) 447 WP_042230641.1 competence type IV pilus minor pilin ComGF Machinery gene
  LILO_RS10890 (lilo_2101) comGE 2252108..2252404 (-) 297 WP_015427164.1 competence type IV pilus minor pilin ComGE Machinery gene
  LILO_RS10895 (lilo_2102) comGD 2252376..2252807 (-) 432 WP_015427165.1 competence type IV pilus minor pilin ComGD Machinery gene
  LILO_RS10900 (lilo_2103) comGC 2252767..2253150 (-) 384 WP_015427166.1 competence type IV pilus major pilin ComGC Machinery gene
  LILO_RS10905 (lilo_2104) comGB 2253164..2254237 (-) 1074 WP_080619357.1 competence type IV pilus assembly protein ComGB Machinery gene
  LILO_RS10910 (lilo_2105) comGA 2254131..2255069 (-) 939 WP_015427168.1 competence type IV pilus ATPase ComGA Machinery gene
  LILO_RS11780 - 2255339..2256295 (-) 957 WP_052312061.1 hypothetical protein -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10771.95 Da        Isoelectric Point: 4.7596

>NTDB_id=46129 LILO_RS10880 WP_015427162.1 2251376..2251660(-) (comGG) [Lactococcus lactis subsp. lactis IO-1]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGTSFQIKN

Nucleotide


Download         Length: 285 bp        

>NTDB_id=46129 LILO_RS10880 WP_015427162.1 2251376..2251660(-) (comGG) [Lactococcus lactis subsp. lactis IO-1]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGGGATT
TGTCCTACAATTTACTGACAGACTCGTCAGCTAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCACAAGCTTTCAAATAAAAAATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.065

98.936

0.574


Multiple sequence alignment