Detailed information
Bioinformatically predicted
Overview
| Name | HI0659 | Type | Machinery gene |
| Locus tag | MOUSESFB_RS00790 | Genome accession | NC_017294 |
| Coordinates | 155360..155596 (-) | Length | 78 a.a. |
| NCBI ID | WP_005807464.1 | Uniprot ID | A0AAV3EI49 |
| Organism | Candidatus Arthromitus sp. SFB-mouse-Yit | ||
| Function | DNA uptake (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 155360..173284 | 155360..155596 | within | 0 |
| Prophage | 110438..155059 | 155360..155596 | flank | 301 |
Gene organization within MGE regions
Location: 110438..173284
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MOUSESFB_RS07895 | rlmD | 110438..111217 (+) | 780 | WP_007443020.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| MOUSESFB_RS00505 (MOUSESFB_0085) | - | 111270..112460 (-) | 1191 | WP_005807580.1 | site-specific integrase | - |
| MOUSESFB_RS00510 (MOUSESFB_0086) | - | 112695..113999 (+) | 1305 | WP_005807578.1 | ATP/GTP-binding protein | - |
| MOUSESFB_RS00515 (MOUSESFB_0087) | - | 114000..114587 (+) | 588 | WP_005807576.1 | hypothetical protein | - |
| MOUSESFB_RS00520 | - | 115245..115496 (-) | 252 | WP_005807574.1 | LexA family transcriptional regulator | - |
| MOUSESFB_RS00525 (MOUSESFB_0088) | - | 115839..116573 (+) | 735 | WP_005807572.1 | DUF3644 domain-containing protein | - |
| MOUSESFB_RS00530 (MOUSESFB_0089) | - | 117316..117822 (-) | 507 | WP_005807569.1 | hypothetical protein | - |
| MOUSESFB_RS00535 (MOUSESFB_0090) | - | 117859..118350 (-) | 492 | WP_242821485.1 | LexA family transcriptional regulator | - |
| MOUSESFB_RS07900 | - | 118357..118473 (-) | 117 | Protein_93 | LexA family transcriptional regulator | - |
| MOUSESFB_RS00540 (MOUSESFB_0091) | - | 118648..118866 (+) | 219 | WP_005807564.1 | helix-turn-helix transcriptional regulator | - |
| MOUSESFB_RS00545 (MOUSESFB_0092) | - | 118873..119088 (-) | 216 | WP_005807562.1 | helix-turn-helix domain-containing protein | - |
| MOUSESFB_RS00550 (MOUSESFB_0093) | - | 119207..119407 (+) | 201 | WP_005807560.1 | helix-turn-helix transcriptional regulator | - |
| MOUSESFB_RS00555 | - | 119462..119680 (+) | 219 | WP_005807558.1 | helix-turn-helix domain-containing protein | - |
| MOUSESFB_RS00560 | - | 119685..119864 (+) | 180 | WP_005807556.1 | hypothetical protein | - |
| MOUSESFB_RS00565 | - | 119950..120216 (+) | 267 | WP_005807554.1 | hypothetical protein | - |
| MOUSESFB_RS00570 (MOUSESFB_0094) | - | 120233..120532 (+) | 300 | WP_005807552.1 | hypothetical protein | - |
| MOUSESFB_RS00575 (MOUSESFB_0095) | - | 120532..121668 (+) | 1137 | WP_005807550.1 | DUF2800 domain-containing protein | - |
| MOUSESFB_RS00580 (MOUSESFB_0096) | - | 121684..122244 (+) | 561 | WP_005807548.1 | DUF2815 family protein | - |
| MOUSESFB_RS00585 (MOUSESFB_0097) | - | 122244..124163 (+) | 1920 | WP_005807546.1 | DNA polymerase | - |
| MOUSESFB_RS00590 (MOUSESFB_0098) | - | 124179..126674 (+) | 2496 | WP_005807544.1 | virulence-associated E family protein | - |
| MOUSESFB_RS00595 (MOUSESFB_0099) | - | 126969..127277 (+) | 309 | WP_005807543.1 | VRR-NUC domain-containing protein | - |
| MOUSESFB_RS00600 (MOUSESFB_0100) | - | 127229..128569 (+) | 1341 | WP_005807541.1 | SNF2-related protein | - |
| MOUSESFB_RS00605 (MOUSESFB_0101) | - | 128573..129007 (+) | 435 | WP_005807538.1 | hypothetical protein | - |
| MOUSESFB_RS00610 (MOUSESFB_0102) | - | 128994..129206 (+) | 213 | WP_005807536.1 | helix-turn-helix domain-containing protein | - |
| MOUSESFB_RS00615 (MOUSESFB_0103) | - | 129284..130000 (+) | 717 | WP_007440106.1 | SHOCT domain-containing protein | - |
| MOUSESFB_RS00620 (MOUSESFB_0104) | - | 130164..130586 (+) | 423 | WP_005807533.1 | terminase small subunit | - |
| MOUSESFB_RS00625 (MOUSESFB_0105) | - | 130583..131014 (+) | 432 | WP_005807531.1 | dATP/dGTP diphosphohydrolase domain-containing protein | - |
| MOUSESFB_RS00630 (MOUSESFB_0106) | - | 131029..132276 (+) | 1248 | WP_005807529.1 | PBSX family phage terminase large subunit | - |
| MOUSESFB_RS00635 (MOUSESFB_0107) | - | 132317..132796 (-) | 480 | WP_007440341.1 | DUF2442 domain-containing protein | - |
| MOUSESFB_RS00640 (MOUSESFB_0108) | - | 132837..133091 (-) | 255 | WP_007440342.1 | DUF4160 domain-containing protein | - |
| MOUSESFB_RS00645 (MOUSESFB_0109) | - | 133187..134575 (+) | 1389 | WP_005807523.1 | phage portal protein | - |
| MOUSESFB_RS00650 (MOUSESFB_0110) | - | 134568..136151 (+) | 1584 | WP_005807521.1 | minor capsid protein | - |
| MOUSESFB_RS00655 | - | 136155..136361 (+) | 207 | WP_005807519.1 | hypothetical protein | - |
| MOUSESFB_RS00660 (MOUSESFB_0111) | - | 136385..136735 (+) | 351 | WP_005806954.1 | YjcQ family protein | - |
| MOUSESFB_RS00665 (MOUSESFB_0112) | - | 136821..137498 (+) | 678 | WP_005807517.1 | Panacea domain-containing protein | - |
| MOUSESFB_RS00670 (MOUSESFB_0113) | - | 137695..138294 (+) | 600 | WP_005807516.1 | phage scaffolding protein | - |
| MOUSESFB_RS00675 (MOUSESFB_0114) | - | 138303..139361 (+) | 1059 | WP_005807514.1 | hypothetical protein | - |
| MOUSESFB_RS00680 (MOUSESFB_0115) | - | 139368..139748 (+) | 381 | WP_005807512.1 | hypothetical protein | - |
| MOUSESFB_RS00685 (MOUSESFB_0116) | - | 139742..140098 (+) | 357 | WP_014017809.1 | hypothetical protein | - |
| MOUSESFB_RS00690 (MOUSESFB_0117) | - | 140098..140505 (+) | 408 | WP_005807507.1 | HK97 gp10 family phage protein | - |
| MOUSESFB_RS00695 (MOUSESFB_0118) | - | 140502..140930 (+) | 429 | WP_005807505.1 | DUF6838 family protein | - |
| MOUSESFB_RS00700 | - | 140935..141123 (+) | 189 | WP_005807504.1 | hypothetical protein | - |
| MOUSESFB_RS00705 (MOUSESFB_0119) | - | 141125..142426 (+) | 1302 | WP_005807500.1 | phage tail sheath family protein | - |
| MOUSESFB_RS00710 (MOUSESFB_0120) | - | 142438..142914 (+) | 477 | WP_005807498.1 | phage tail tube protein | - |
| MOUSESFB_RS00715 (MOUSESFB_0121) | - | 142916..143347 (+) | 432 | WP_005807496.1 | hypothetical protein | - |
| MOUSESFB_RS00720 | - | 143542..145419 (+) | 1878 | WP_005807492.1 | tape measure protein | - |
| MOUSESFB_RS07905 | - | 145535..146203 (+) | 669 | WP_242821478.1 | phage tail protein | - |
| MOUSESFB_RS00730 (MOUSESFB_0122) | - | 146203..146904 (+) | 702 | WP_005807488.1 | hypothetical protein | - |
| MOUSESFB_RS00735 (MOUSESFB_0123) | - | 146907..147866 (+) | 960 | WP_005807486.1 | hypothetical protein | - |
| MOUSESFB_RS00740 (MOUSESFB_0124) | - | 147859..148179 (+) | 321 | WP_005807484.1 | DUF2577 domain-containing protein | - |
| MOUSESFB_RS00745 (MOUSESFB_0125) | - | 148176..148583 (+) | 408 | WP_005807482.1 | DUF2634 domain-containing protein | - |
| MOUSESFB_RS00750 (MOUSESFB_0126) | - | 148583..149653 (+) | 1071 | WP_005807480.1 | baseplate J/gp47 family protein | - |
| MOUSESFB_RS00755 (MOUSESFB_0127) | - | 149640..150329 (+) | 690 | WP_005807479.1 | putative phage tail protein | - |
| MOUSESFB_RS00760 (MOUSESFB_0128) | - | 150316..151080 (+) | 765 | WP_005807478.1 | hypothetical protein | - |
| MOUSESFB_RS00765 (MOUSESFB_0129) | - | 151085..151930 (+) | 846 | WP_007441037.1 | hypothetical protein | - |
| MOUSESFB_RS00770 (MOUSESFB_0130) | - | 151930..153639 (+) | 1710 | WP_005807474.1 | phage tail protein | - |
| MOUSESFB_RS00775 (MOUSESFB_0131) | - | 153833..154264 (+) | 432 | WP_007439697.1 | holin family protein | - |
| MOUSESFB_RS00780 (MOUSESFB_0132) | - | 154409..155059 (+) | 651 | WP_005807468.1 | N-acetylmuramoyl-L-alanine amidase | - |
| MOUSESFB_RS00785 (MOUSESFB_0133) | - | 155106..155354 (-) | 249 | WP_005807466.1 | DUF4160 domain-containing protein | - |
| MOUSESFB_RS00790 (MOUSESFB_0134) | HI0659 | 155360..155596 (-) | 237 | WP_005807464.1 | helix-turn-helix domain-containing protein | Machinery gene |
| MOUSESFB_RS00795 (MOUSESFB_0135) | - | 155604..155861 (-) | 258 | WP_005807462.1 | DUF2442 domain-containing protein | - |
| MOUSESFB_RS00800 | - | 156054..156266 (+) | 213 | WP_005807460.1 | DUF4214 domain-containing protein | - |
| MOUSESFB_RS00805 (MOUSESFB_0136) | - | 156687..158219 (+) | 1533 | WP_005807458.1 | hypothetical protein | - |
| MOUSESFB_RS00810 (MOUSESFB_0137) | lepB | 158289..158981 (+) | 693 | WP_005807456.1 | signal peptidase I | - |
| MOUSESFB_RS00815 (MOUSESFB_0138) | - | 159064..161151 (+) | 2088 | WP_005807454.1 | UvrD-helicase domain-containing protein | - |
| MOUSESFB_RS00820 (MOUSESFB_0139) | - | 161148..162134 (-) | 987 | WP_005807452.1 | hypothetical protein | - |
| MOUSESFB_RS00825 (MOUSESFB_0140) | - | 162207..163421 (-) | 1215 | WP_014518655.1 | cation diffusion facilitator family transporter | - |
| MOUSESFB_RS00830 (MOUSESFB_0141) | - | 163527..164726 (+) | 1200 | WP_005807447.1 | aspartate kinase | - |
| MOUSESFB_RS00835 (MOUSESFB_0142) | lysA | 164741..166021 (+) | 1281 | WP_005807445.1 | diaminopimelate decarboxylase | - |
| MOUSESFB_RS00840 (MOUSESFB_0143) | - | 166089..167228 (+) | 1140 | WP_005807444.1 | hypothetical protein | - |
| MOUSESFB_RS00845 (MOUSESFB_0144) | - | 167250..168530 (+) | 1281 | WP_005807442.1 | M18 family aminopeptidase | - |
| MOUSESFB_RS00850 (MOUSESFB_0145) | ispF | 168543..169028 (-) | 486 | WP_005807440.1 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | - |
| MOUSESFB_RS00855 (MOUSESFB_0146) | - | 169042..169773 (-) | 732 | WP_005807438.1 | pseudouridine synthase | - |
| MOUSESFB_RS00860 (MOUSESFB_0147) | - | 169822..170757 (-) | 936 | WP_005807437.1 | hypothetical protein | - |
| MOUSESFB_RS00865 (MOUSESFB_0148) | - | 171011..171763 (+) | 753 | WP_005807435.1 | DUF3298 and DUF4163 domain-containing protein | - |
| MOUSESFB_RS00870 | - | 171859..172176 (+) | 318 | Protein_160 | ArsC/Spx/MgsR family protein | - |
| MOUSESFB_RS00875 (MOUSESFB_0149) | - | 172196..172825 (-) | 630 | WP_005807431.1 | hypothetical protein | - |
| MOUSESFB_RS00880 (MOUSESFB_0150) | - | 172925..173284 (-) | 360 | WP_005807428.1 | DUF1540 domain-containing protein | - |
Sequence
Protein
Download Length: 78 a.a. Molecular weight: 8873.63 Da Isoelectric Point: 10.5513
>NTDB_id=45950 MOUSESFB_RS00790 WP_005807464.1 155360..155596(-) (HI0659) [Candidatus Arthromitus sp. SFB-mouse-Yit]
MIEEKIKEIVSEIIKLRQENGLTQKQLEELSNIKQPIIARMEKGTNIPQLNTILKLLKPLGKTIAIVPLETTKPTKSR
MIEEKIKEIVSEIIKLRQENGLTQKQLEELSNIKQPIIARMEKGTNIPQLNTILKLLKPLGKTIAIVPLETTKPTKSR
Nucleotide
Download Length: 237 bp
>NTDB_id=45950 MOUSESFB_RS00790 WP_005807464.1 155360..155596(-) (HI0659) [Candidatus Arthromitus sp. SFB-mouse-Yit]
ATGATTGAAGAAAAGATAAAAGAAATTGTATCCGAAATAATAAAACTTAGACAGGAAAATGGACTCACACAGAAACAACT
TGAAGAGTTAAGCAACATAAAACAACCAATTATAGCGAGGATGGAAAAAGGAACAAATATACCACAACTTAACACTATTT
TAAAATTACTAAAACCCTTAGGGAAAACAATTGCAATAGTTCCTCTTGAAACAACAAAACCAACTAAATCGAGGTGA
ATGATTGAAGAAAAGATAAAAGAAATTGTATCCGAAATAATAAAACTTAGACAGGAAAATGGACTCACACAGAAACAACT
TGAAGAGTTAAGCAACATAAAACAACCAATTATAGCGAGGATGGAAAAAGGAACAAATATACCACAACTTAACACTATTT
TAAAATTACTAAAACCCTTAGGGAAAACAATTGCAATAGTTCCTCTTGAAACAACAAAACCAACTAAATCGAGGTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| HI0659 | Haemophilus influenzae Rd KW20 |
57.534 |
93.59 |
0.538 |