Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   KSO_RS04570 Genome accession   NC_020272
Coordinates   905197..905337 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens IT-45     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 900197..910337
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KSO_RS04545 (KSO_004725) - 900503..900901 (+) 399 WP_003152031.1 YueI family protein -
  KSO_RS04550 (KSO_004730) - 900998..901549 (+) 552 WP_003152033.1 cysteine hydrolase family protein -
  KSO_RS04555 (KSO_004735) - 901567..903033 (+) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  KSO_RS04560 (KSO_004740) - 903163..904383 (+) 1221 WP_015387782.1 EAL and HDOD domain-containing protein -
  KSO_RS04565 (KSO_004745) - 904390..904731 (-) 342 WP_014305721.1 hypothetical protein -
  KSO_RS04570 (KSO_004755) degQ 905197..905337 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  KSO_RS04575 (KSO_004760) comQ 905489..906400 (+) 912 WP_014305720.1 polyprenyl synthetase family protein Regulator
  KSO_RS04580 (KSO_004765) comX 906400..906564 (+) 165 WP_007613432.1 competence pheromone ComX -
  KSO_RS04585 (KSO_004770) comP 906576..908867 (+) 2292 WP_015387784.1 histidine kinase Regulator
  KSO_RS04590 (KSO_004775) comA 908948..909592 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  KSO_RS04595 (KSO_004780) - 909614..909997 (+) 384 WP_003152054.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=45878 KSO_RS04570 WP_003152043.1 905197..905337(+) (degQ) [Bacillus amyloliquefaciens IT-45]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=45878 KSO_RS04570 WP_003152043.1 905197..905337(+) (degQ) [Bacillus amyloliquefaciens IT-45]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment