Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   JHX97_RS00925 Genome accession   NZ_CP067009
Coordinates   146355..146639 (+) Length   94 a.a.
NCBI ID   WP_041174183.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain iGAS391     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 141355..151639
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JHX97_RS00900 (JHX97_00900) - 143301..143666 (+) 366 WP_002986560.1 DUF1033 family protein -
  JHX97_RS00905 (JHX97_00905) comGA 143759..144697 (+) 939 WP_011888534.1 competence type IV pilus ATPase ComGA Machinery gene
  JHX97_RS00910 (JHX97_00910) comGB 144633..145667 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  JHX97_RS00915 (JHX97_00915) comGC 145669..145995 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  JHX97_RS00920 (JHX97_00920) comGD 145970..146398 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  JHX97_RS00925 (JHX97_00925) comGE 146355..146639 (+) 285 WP_041174183.1 competence type IV pilus minor pilin ComGE Machinery gene
  JHX97_RS00930 (JHX97_00930) comGF 146632..147066 (+) 435 WP_002986542.1 competence type IV pilus minor pilin ComGF Machinery gene
  JHX97_RS00935 (JHX97_00935) comGG 147050..147376 (+) 327 WP_002986539.1 competence type IV pilus minor pilin ComGG -
  JHX97_RS00940 (JHX97_00940) comGH 147474..148427 (+) 954 WP_002987790.1 class I SAM-dependent methyltransferase Machinery gene
  JHX97_RS00945 (JHX97_00945) - 148486..149682 (+) 1197 WP_011888536.1 acetate kinase -
  JHX97_RS00950 (JHX97_00950) - 149869..150177 (+) 309 WP_011017251.1 hypothetical protein -
  JHX97_RS00955 (JHX97_00955) proC 150260..151030 (-) 771 WP_002986527.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10702.71 Da        Isoelectric Point: 8.9043

>NTDB_id=456844 JHX97_RS00925 WP_041174183.1 146355..146639(+) (comGE) [Streptococcus pyogenes strain iGAS391]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALMYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=456844 JHX97_RS00925 WP_041174183.1 146355..146639(+) (comGE) [Streptococcus pyogenes strain iGAS391]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAATGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAT
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383