Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   HUZ39_RS15260 Genome accession   NZ_CP055199
Coordinates   3071353..3071982 (-) Length   209 a.a.
NCBI ID   WP_106464856.1    Uniprot ID   -
Organism   Shigella flexneri strain STEFF_3     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3062181..3099556 3071353..3071982 within 0


Gene organization within MGE regions


Location: 3062181..3099556
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HUZ39_RS15210 (HUZ39_15100) tusE 3062452..3062781 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  HUZ39_RS15215 (HUZ39_15105) yccX 3062778..3063056 (-) 279 WP_000048249.1 acylphosphatase -
  HUZ39_RS15220 (HUZ39_15110) rlmI 3063151..3064341 (+) 1191 WP_000116297.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  HUZ39_RS15225 (HUZ39_15115) hspQ 3064399..3064716 (+) 318 WP_001295356.1 heat shock protein HspQ -
  HUZ39_RS15230 (HUZ39_15120) - 3064761..3065174 (-) 414 WP_000665217.1 CoA-binding protein -
  HUZ39_RS15235 (HUZ39_15125) - 3065347..3066009 (+) 663 WP_000847791.1 DUF2057 family protein -
  HUZ39_RS15240 (HUZ39_15130) mgsA 3066105..3066563 (+) 459 WP_000424181.1 methylglyoxal synthase -
  HUZ39_RS15245 (HUZ39_15135) helD 3066595..3068649 (-) 2055 WP_000420533.1 DNA helicase IV -
  HUZ39_RS15250 (HUZ39_15140) - 3068772..3069218 (+) 447 WP_001261231.1 YccF domain-containing protein -
  HUZ39_RS15255 (HUZ39_15145) yccS 3069228..3071390 (+) 2163 WP_000875020.1 YccS family putative transporter -
  HUZ39_RS15260 (HUZ39_15150) sxy/tfoX 3071353..3071982 (-) 630 WP_106464856.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  HUZ39_RS15265 (HUZ39_15155) sulA 3072201..3072710 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  HUZ39_RS15270 (HUZ39_15160) ompA 3073067..3074107 (+) 1041 WP_000750416.1 porin OmpA -
  HUZ39_RS15275 (HUZ39_15165) matP 3074183..3074635 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  HUZ39_RS15280 (HUZ39_15170) - 3074821..3076581 (+) 1761 WP_000156526.1 Lon protease family protein -
  HUZ39_RS15285 (HUZ39_15175) fabA 3076650..3077168 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  HUZ39_RS15290 (HUZ39_15180) rmf 3077238..3077405 (-) 168 WP_000828648.1 ribosome modulation factor -
  HUZ39_RS15295 (HUZ39_15185) pqiC 3077661..3078224 (-) 564 WP_000759120.1 membrane integrity-associated transporter subunit PqiC -
  HUZ39_RS15300 (HUZ39_15190) pqiB 3078221..3079861 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  HUZ39_RS15305 (HUZ39_15195) pqiA 3079866..3081119 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  HUZ39_RS15310 (HUZ39_15200) - 3081249..3083156 (-) 1908 WP_000053124.1 ABC transporter ATP-binding protein -
  HUZ39_RS15315 (HUZ39_15205) rlmKL 3083168..3085276 (-) 2109 WP_001086526.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  HUZ39_RS15320 (HUZ39_15210) ycbX 3085520..3086629 (+) 1110 WP_000224273.1 6-N-hydroxylaminopurine resistance protein YcbX -
  HUZ39_RS15325 (HUZ39_15215) zapC 3086626..3087168 (-) 543 WP_001295353.1 cell division protein ZapC -
  HUZ39_RS15330 (HUZ39_15220) pyrD 3087342..3088352 (-) 1011 WP_001295352.1 quinone-dependent dihydroorotate dehydrogenase -
  HUZ39_RS15335 (HUZ39_15225) - 3088463..3089200 (-) 738 WP_001111470.1 fimbrial chaperone -
  HUZ39_RS15340 (HUZ39_15230) - 3089166..3089681 (-) 516 WP_000919489.1 fimbrial protein -
  HUZ39_RS15345 (HUZ39_15235) - 3089689..3090231 (-) 543 WP_000730614.1 fimbrial protein -
  HUZ39_RS15350 (HUZ39_15240) - 3090243..3091313 (-) 1071 WP_001165658.1 fimbrial protein -
  HUZ39_RS15355 (HUZ39_15245) - 3091304..3093304 (-) 2001 Protein_3026 fimbrial biogenesis usher protein -
  HUZ39_RS15360 (HUZ39_15250) - 3093313..3094287 (-) 975 WP_012478345.1 IS30-like element ISApl1 family transposase -
  HUZ39_RS15365 (HUZ39_15255) - 3094364..3094976 (-) 613 Protein_3028 FimD/PapC N-terminal domain-containing protein -
  HUZ39_RS15370 (HUZ39_15260) - 3095001..3095702 (-) 702 WP_000845152.1 molecular chaperone -
  HUZ39_RS15375 (HUZ39_15265) - 3095785..3096327 (-) 543 WP_106464855.1 fimbrial protein -
  HUZ39_RS15380 (HUZ39_15270) ssuE 3096683..3097258 (+) 576 WP_001263933.1 NADPH-dependent FMN reductase -
  HUZ39_RS15385 (HUZ39_15275) ssuA 3097251..3098210 (+) 960 WP_001244342.1 aliphatic sulfonate ABC transporter substrate-binding protein SsuA -
  HUZ39_RS15390 (HUZ39_15280) ssuD 3098207..3099352 (+) 1146 WP_239637907.1 FMNH2-dependent alkanesulfonate monooxygenase -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24193.10 Da        Isoelectric Point: 9.0428

>NTDB_id=456790 HUZ39_RS15260 WP_106464856.1 3071353..3071982(-) (sxy/tfoX) [Shigella flexneri strain STEFF_3]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLECAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=456790 HUZ39_RS15260 WP_106464856.1 3071353..3071982(-) (sxy/tfoX) [Shigella flexneri strain STEFF_3]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAATGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.522

100

0.995